EF1708 (E. faecalis )
In pSB3 (His-tagged bacterial expression vector)

Explanation of Terms

Gene:
Gene Symbol:  EF1708
Gene Name:  None
Original Clone ID:
3339a1TCt5b1
Keyword:
None
Species:
Enterococcus faecalis
Type:
cDNA
Vector Name:
pSB3
Format: 
CLOSED
Source:
New York SGX Research Center for Structural Genomics
Description:
None
Comments:
"C-terminal 6-His, TOPO"
Mutation / Discrepancy:
No / Yes
Publications:
None
Authors:
PSI
New York SGX Research Center for Structural Genomics
EfCD00285372
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 1317nts
Open reading frame: 51 to 1367

CCCTCTGAATAATTTTGTTAACTTTAGAAGGAGATATACATATGTCCCTTGTTTATACAG
AAGTTCCAAAATCCGTAGCAACATTTATGGAGACAATTACAGAAAAATGCGGTGAAGCAC
ATCAAGATTGGGCAAAAAACTTTCAGGCGGCCTTTGCCAATACTTTACTAACAACAGTGA
AACGTCAAGAAGATGGTACTACCTTTTTATTAACAGGCGATATTCCGGCAATGTGGTTGA
GAGACTCAACAGCACAAGTTCGTCCCTATTTAGTGATTGCGAAAGAAGACGAAGACCTTG
CTCAAATGATTGCTGGTTTGGTTAAACGCCAGTTTCGTTATATTTGCATTGATCCTTATG
CCAATGCGTTTAATGAAACAGATAATCATGCAGGCCATCAAACTGATAAGACAGAAATGA
ATGGCTGGATTTGGGAACGGAAATATGAAATTGATTCATTATGTTACCCGGTCCAATTAG
CCTATTTACTTTATAAAAATACTGGGATGACCGAACAATTTAATTCAGATTTTGTGGAAG
GCGTCAAAAAAATTCTCAACGTTTTTACAACAGAACAAGATCACGCACAGTCACCTTATT
TATTTGAACGAGATACGTGGCGTCAAGAAGATACGTTGGTTGAAGCAGGGAAAGGAACAC
CAGTTGGCAAAACAGGGATGACATGGTCAGGCTTCCGTCCTAGTGATGATGCCTGCCAAT
ATGGTTACTTAGTTCCTTCTAATATGTTTGCAGTCGTAATTTTAGGCTATATTCAAGAAA
TTTTCTCTGATGTTTTAGAAGATGCTACGATTGGGGCGATTGCTAAAAAATTACAAGAAG
AGATTGAAGAAGGCATCCAAACATTTGGACGAACAAAAAATCAAAATAACGAAACGATTT
ACGCGTATGAAGTGGATGGCTTAGGCAATGCAAGCGTGATGGATGACAGTAATGTTCCCA
ATTTAGTAGCAGCCCCTTATCTGGGTTATTGTTCAACAGAGGATGAACAATATTTAACAA
CGCGTCAAACCTTATTAAGTAAAGAAAATCCTTACTTCTATGAAGGCAAATACGCGAAAG
GGATTGGTAGCTCGCATACACCAGAAAATTACGTGTGGCCGATTGCTTTAGCAATGGAAG
GAATGACAACCAAAGATAAAGCAGAAAAAGAACGAATTTTAGATTTATTAGTTGCCACAG
ATGCGGGGACTCATTTGATGCATGAAGGTTTTGACGTAGATAATCCTGAAAATTATACAA
GAGAATGGTTTTCATGGGCTAATATGATGTTTTGTGAATTAGTTATGGATTATTTTGACA
TCCGAGTGGAAAAAGAAGGGGGATCCCACCACCACCACCACCACTGAGATCCGAATTCGA
GCTCCGTCGACAAGCTTGCGGACGCACTCGAGCACC

Protein sequence predicted based on nucleotide sequence

VYTEVPKSVATFMETITEKCGEAHQDWAKNFQAAFANTLLTTVKRQEDGTTFLLTGDIPA
MWLRDSTAQVRPYLVIAKEDEDLAQMIAGLVKRQFRYICIDPYANAFNETDNHAGHQTDK
TEMNGWIWERKYEIDSLCYPVQLAYLLYKNTGMTEQFNSDFVEGVKKILNVFTTEQDHAQ
SPYLFERDTWRQEDTLVEAGKGTPVGKTGMTWSGFRPSDDACQYGYLVPSNMFAVVILGY
IQEIFSDVLEDATIGAIAKKLQEEIEEGIQTFGRTKNQNNETIYAYEVDGLGNASVMDDS
NVPNLVAAPYLGYCSTEDEQYLTTRQTLLSKENPYFYEGKYAKGIGSSHTPENYVWPIAL
AMEGMTTKDKAEKERILDLLVATDAGTHLMHEGFDVDNPENYTREWFSWANMMFCELVMD
YFDIRVEKEGGSHHHHHH*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Reference Sequence Annotations:
Start on reference sequence 1
End on reference sequence 1317
Mutations:
None
Discrepancy:
a177g,P59P;
                                                    

5' Linker Sequence:
ATGTCCCTT
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: 50ug/mL kanamycin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Conditions for Gateway-type vectors in recombined (with insert) form and other kanamycin resistant vectors.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
ProteinPurified: Protein_Purified
SolubleProtein: Protein_Soluble
Find experimental protocols in NYSGXRC-3339a
Recommended expression in:
Not Applicable