CGA (Homo sapiens) in pENTR223 (Gateway donor/master vector)

Explanation of Terms

Gene:
Gene Symbol:  CGA
Gene Name:  glycoprotein hormones, alpha polypeptide
Original Clone ID:
6025
Keyword:
None
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pENTR223
Format: 
FUSION
Source:
The ORFeome Collaboration
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
The ORFeome Collaboration
HsCD00289235
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: None
Insert sequence: 351nts
Open reading frame: 1 to 351

ATGGATTACTACAGAAAATATGCAGCTATCTTTCTGGTCACATTGTCGGTGTTTCTGCAT
GTTCTCCATTCCGCTCCTGATGTGCAGGATTGCCCAGAATGCACGCTACAGGAAAACCCA
CTCTTCTCCCAGCCGGGTGCCCCAATACTTCAGTGCATGGGCTGCTGCTTCTCTAGAGCA
TATCCCACTCCACTAAGGTCCAAGAAGACGATGTTGGTCCAAAAGAACGTCACCTCAGAG
TCCACTTGCTGTGTAGCTAAATCATATAACAGGGTCACAGTAATGGGGGGTTTCAAAGTG
GAGAACCACACGGCGTGCCACTGCAGTACTTGTTATTATCACAAATCTTAC

Protein sequence predicted based on nucleotide sequence

MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPLFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSY

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Reference Sequence Annotations:
Start on reference sequence 106
End on reference sequence 456
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
GTACAAAAAAGTTGGC
3' Linker Sequence:
5p (goi-stop)CCAACTTTCTTGTAC

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  spectinomycin
Bacterial Selection Condition: 100 ug/mL spectinomycin
Growth Condition: Growth at 37 degrees C in LB supplemented with 100 ug/mL spectinomycin.
Comments: None
Protein Expression Results:
None
Recommended expression in:
Not Applicable