AT1G56620 (A. thaliana Columbia )
In pDONR221 (Gateway donor/master vector)

Explanation of Terms

Gene:
Gene Symbol:  AT1G56620
Gene Name:  pectinesterase inhibitor domain-containing protein
Original Clone ID:
5425.1.20_GO.2742
Keyword:
full-length cds
Species:
Arabidopsis thaliana Columbia
Type:
cDNA
Vector Name:
pDONR221
Format: 
CLOSED
Source:
Center for Eukaryotic Structural Genomics
Description:
None
Comments:
This is a GATEWAY entry clone having a TEV protease cleavage site fused to the open reading frame with the initiation codon replaced with TCC.
Mutation / Discrepancy:
No / Yes
Publications:
None
Authors:
PSI
Center for Eukaryotic Structural Genomics
AtCD00330519
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 558nts
Open reading frame: 1 to 558

GAAAACCTGTACTTCCAGTCCGGTTTTCTTCAACGAATCTCTTTGATGATCACATCTTTG
ATCATTCTGCACACTATCCCATCGACCACATCCATCTCAATCACACCAGACGCCCCAACA
ATGATTCTAATCGATAGCATATGTGTCAACACCAAGAACATGTATTATTGTGAGCAAAGT
ATCATCTCGAAACTCGGTAACCCCCATGCAGAAATCAAGACCATAGCTGATATCGCAGCG
TTCAACGCAGTGTACCTCATCACAAGTGCAGGCAATTACATTAGAGATAAATTTATTCCC
ATAGCAGAGAACCCTCTGGTCAAGAACCAGCTTGTTCTTTGCCTTGCGACGTACAGAGCT
GTACAAAAGCTTCTCGAAGGTGCTTATCTGGCAGACCGCCGAGGTGATTATTCGGATATG
AGACACTATCAATCAAGTGTGCTTGGTATGCTCGATAATTGTAAAACAGATTTTGATTAT
ATGGTGCGTACAAATTGGGGGGTTAGGTTAATGATCAATATCTCTTTATTAGCAACTCGT
CAGCTCCCTGCACAATAG

Protein sequence predicted based on nucleotide sequence

ENLYFQSGFLQRISLMITSLIILHTIPSTTSISITPDAPTMILIDSICVNTKNMYYCEQS
IISKLGNPHAEIKTIADIAAFNAVYLITSAGNYIRDKFIPIAENPLVKNQLVLCLATYRA
VQKLLEGAYLADRRGDYSDMRHYQSSVLGMLDNCKTDFDYMVRTNWGVRLMINISLLATR
QLPAQ*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
a558g,*186*,
                                                    

5' Linker Sequence:
CCAACTTTGTACAAAAAAGCAGGCTCC
3' Linker Sequence:
GACCCAGCTTTCTTGTACAAAGTTGGC

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: 50ug/mL kanamycin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Conditions for Gateway-type vectors in recombined (with insert) form and other kanamycin resistant vectors.
Protein Expression Results:
ProteinExpressed: Not_Applicable
ProteinPurified: Not_Applicable
SolubleProtein: Not_Applicable
Find experimental protocols in GO.2742
Recommended expression in:
Not Applicable