AT4G25250 (Arabidopsis thaliana Columbia) in pVP13

Explanation of Terms

Gene:
Gene Symbol:  AT4G25250
Gene Name:  invertase/pectin methylesterase inhibitor family protein
Original Clone ID:
5463.1.50_GO.19047
Keyword:
full-length cds (mutant)
Species:
Arabidopsis thaliana Columbia
Type:
cDNA
Vector Name:
pVP13
Format: 
CLOSED
Source:
Center for Eukaryotic Structural Genomics
Description:
None
Comments:
His8-MBP fusion protein with TEV protease cleavage site is produced; after cleavage the protein obtained will be the translated CDS with the addition of SER at the N-term
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
PSI
Center for Eukaryotic Structural Genomics
AtCD00334105
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 546nts
Open reading frame: 1 to 546

GAAAACCTGTACTTCCAGTCCACCCCACCAGGCACGTACCAAAACCACACAACGTACGTA
AAAACGGCATGCAACTCAACAACATACCCTACAATGTGCTACAACTGTCTGTCCTCCTAT
TCCTCCACCATCAAGTCCGACCCAATCAAACTATGCACAACATCGCTAAATCTCAACGTC
AAATCCGCTAAAAACGCCACATTAGTCGTCTCTAACCTTCTCCAAAAGGCCAAAGCCGCG
AAAAGCCATGAAGTCTCGATCCTTAAGGACTGCGTGGACGAGATGAAGGACACTATCGAC
GAGCTTAAGCAAGCGGTCGCCGAGATGAAGTATGTCAGAGGCGGAGGGAAAACTACGGAG
GAGCATTTAAAGAACGTGAAGACGTGGGTGAGCTCGGCTTTGACCGACGAGGGCACGTGT
ACGGACGGATTCGAGGAAGGGAGAGTAAATGTGGAAACAAAGAAGAAGGTGAAGAAGGCT
ATTTCTGAGCTTTCAAAGACTACAAGCAATACTTTAGCCCTTCTTACTCATTATTTAAGT
TATTGA

Protein sequence predicted based on nucleotide sequence

ENLYFQSTPPGTYQNHTTYVKTACNSTTYPTMCYNCLSSYSSTIKSDPIKLCTTSLNLNV
KSAKNATLVVSNLLQKAKAAKSHEVSILKDCVDEMKDTIDELKQAVAEMKYVRGGGKTTE
EHLKNVKTWVSSALTDEGTCTDGFEEGRVNVETKKKVKKAISELSKTTSNTLALLTHYLS
Y*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
ACAAGTTTGTACAAAAAAGCAGGCTCC
3' Linker Sequence:
TAGGACCCAGCTTTCTTGTACAAAGTGGT

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
ProteinPurified: Not_Tested
ProteinExpressed: Protein_Confirmed
SolubleProtein: Protein_Soluble
Find experimental protocols in GO.19047
Recommended expression in:
Not Applicable