phnA (V. cholerae O1 biovar El Tor str. N16961 )
In pANT7_cGST (GST-tagged
In vitro expression vector)

Explanation of Terms

Gene:
Gene Symbol:  phnA
Gene Name:  phnA protein
Original Clone ID:
FLH223741.01F
Keyword:
None
Species:
Vibrio cholerae O1 biovar El Tor str. N16961
Type:
cDNA
Vector Name:
pANT7_cGST
Format: 
FUSION
Source:
HIP
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
VcCD00035519
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: None
Insert sequence: 576nts
Open reading frame: 1 to 576

ATGGGTACTATGTCTACTGAAGCAACTTTACTTGAACGCTGTCAATCACAATGCGAGCTA
TGCGCGGCCTCTACTCCTCTTTCTCCTTTTGTGGTTGCTCCGCATGCCCTCGTCACTGTC
GATCACGCAGTGATGCTGTGTGACACCTGTAAAGGACAAATCGAAAACCCAGAAACGGTG
GATATGAACCATTGGCGTTGTCTGAATGACAGTATGTGGAGCCAAGTTCAACCTGTTCAG
GTTCTCGCATGGCGCCAACTGAAACGTATTTCTGAAACGGAAGGCTGGGCTCGTGATCTG
CTGGATATGATGTATCTTGATGAAGAGACCGCTAAGTGGGCAGAAATTGGCATGGACGAT
GATGCGGAAAAACCACGCGATGTAAATGGTGTCGAGCTGAAAAAAGGTGACGATGTCACC
GTCATCAAAGATCTACCAGTCAAAGGCTCAAGCATGGTCATCAAACAAGGTACTGCAGTA
CGCGGTATCGCGTTAACCGAAGATCCAAAGCACATTCAAGGTAAGGTGAACGGCCAAACC
ATGTACATCATTGCTGAGTATTGCCGTAAAAAGTTG

Protein sequence predicted based on nucleotide sequence

MGTMSTEATLLERCQSQCELCAASTPLSPFVVAPHALVTVDHAVMLCDTCKGQIENPETV
DMNHWRCLNDSMWSQVQPVQVLAWRQLKRISETEGWARDLLDMMYLDEETAKWAEIGMDD
DAEKPRDVNGVELKKGDDVTVIKDLPVKGSSMVIKQGTAVRGIALTEDPKHIQGKVNGQT
MYIIAEYCRKKL

Coding Sequence Details

Insert Sequence Verified?:
N
Verification Method:
Insert was fully sequenced in parent vector
Reference Sequence Annotations:
Start on reference sequence 1
End on reference sequence 576
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
5p GTACAAAAAAGCAGGCTCCACC(atg-goi)
3' Linker Sequence:
5p (goi-stop)GACCCAGCTTTCTTGTAC

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
None
Recommended expression in:
Not Applicable