PTPN22 (H. sapiens )
In pSGX3 (His-tagged bacterial expression vector)

Explanation of Terms

Gene:
Gene Symbol:  PTPN22
Gene Name:  protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
Original Clone ID:
8634a8BCt2p1
Keyword:
full-length cds
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pSGX3
Format: 
CLOSED
Source:
New York SGX Research Center for Structural Genomics
Description:
None
Comments:
Linker not verified. Actual 5' flanking sequence provided below.
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
PSI
New York SGX Research Center for Structural Genomics
HsCD00369582
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 924nts
Open reading frame: 41 to 964

TATTTTGTTAACTTTAGAAGGAGATATACATATGTCCCTTGACCAAAGAGAGATTCTGCA
GAAGTTCCTGGATGAGGCCCAAAGCAAGAAAATTACTAAAGAGGAGTTTGCCAATGAATT
TCTGAAGCTGAAAAGGCAATCTACCAAGTACAAGGCAGACAAAACCTATCCTACAACTGT
GGCTGAGAAGCCCAAGAATATCAAGAAAAACAGATATAAGGATATTTTGCCCTATGATTA
TAGCCGGGTAGAACTATCCCTGATAACCTCTGATGAGGATTCCAGCTACATCAATGCCAA
CTTCATTAAGGGAGTTTATGGACCCAAGGCTTATATTGCCACCCAGGGTCCTTTATCTAC
AACCCTCCTGGACTTCTGGAGGATGATTTGGGAATATAGTGTCCTTATCATTGGTATGGC
ATGCATGGAGTATGAAATGGGAAAGAAAAAGTGTGAGCGCTACTGGGCTGAGCCAGTAGA
GATGCAGCTGGAATTTGGCCCTTTCTCTGTATCCTGTGAAGCTGAAAAAAGGAAATCTGA
TTATATAATCAGGACTCTAAAAGTTAAGTTCAATAGTGAAACTCGAACTATCTACCAGTT
TCATTACAAGAATTGGCCAGACCATGATGTACCTTCATCTATAGACCCTATTCTTGAGCT
CATCTGGGATGTACGTTGTTACCAAGAGGATGACAGTGTTCCCATATGCATTCACTGCAG
TGCTGGCTGTGGAAGGACTGGTGTTATTTGTGCTATTGATTATACATGGATGTTGCTAAA
AGATGGGATAATTCCTGAGAACTTCAGTGTTTTCAGTTTGATCCGGGAAATGCGGACACA
GAGGCCTTCATTAGTTCAAACGCAGGAACAATATGAACTGGTCTACAATGCTGTATTAGA
ACTATTTAAGAGACAGATGGATGTTATCAGAGATAAAGAAGGGCATCATCACCATCACCA
CTGATCCGAATTCGAGCTCCGTCGACAAGCTTGCGGCCGCACTCGAGCACCACCA

Protein sequence predicted based on nucleotide sequence

DQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYK
DILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYS
VLIIGMACMEYEMGKKKCERYWAEPVEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNSE
TRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAID
YTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLELFKRQMDVIRDKE
GHHHHHH*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
ATGTCCCTT
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: 50ug/mL kanamycin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Conditions for Gateway-type vectors in recombined (with insert) form and other kanamycin resistant vectors.
Protein Expression Results:
ProteinPurified: Not_Tested
ProteinExpressed: Protein_Confirmed
SolubleProtein: Tested_Not_Soluble
Find experimental protocols in NYSGXRC-8634a
Recommended expression in:
Not Applicable