Ndufv1 (Mus musculus) in pMH4 (bacterial expression vector)

Explanation of Terms

Gene:
Gene Symbol:  Ndufv1
Gene Name:  NADH dehydrogenase (ubiquinone) flavoprotein 1
Original Clone ID:
11924
Keyword:
full-length cds
Species:
Mus musculus
Type:
cDNA
Vector Name:
pMH4
Format: 
CLOSED
Source:
Joint Center for Structural Genomics
Description:
None
Comments:
Linker not verified.
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
PSI
Joint Center for Structural Genomics
MmCD00382505
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 1395nts
Open reading frame: 34 to 1428

GGATCTGATAAAATTCATCATCATCATCATCACATGCTAGCGGCACGGCATTTTCTCGGC
GGGTTGGTTCCCGTGCGGGTATCTGTGCGTTTCAGCAGCGGCACGACAGCACCCAAGAAA
ACCTCATTTGGCTCACTGAAGGATGAAGACCGGATCTTTACCAACCTGTATGGGCGCCAT
GACTGGAGGCTGAAAGGTGCCCTGAGACGGGGTGACTGGTACAAGACAAAGGAGATCCTG
CTGAAGGGGCCTGACTGGATCTTGGGTGAGATGAAGACATCAGGTTTACGGGGCCGTGGT
GGTGCTGGCTTCCCCACTGGCCTCAAGTGGAGCTTCATGAATAAGCCCTCAGATGGCAGG
CCCAAGTATCTGGTGGTGAATGCTGACGAGGGAGAGCCAGGCACCTGTAAGGACCGAGAG
ATCATGCGTCATGACCCTCACAAGCTGGTGGAAGGCTGCCTTGTGGGAGGCCGGGCCATG
GGAGCCCGGGCCGCCTATATCTACATCCGAGGGGAATTCTACAACGAGGCCTCCAATTTG
CAGGTAGCTATCCGAGAGGCCTATGAAGCAGGTCTGATTGGCAAGAATGCTTGTGGCTCC
GACTATGATTTTGATGTGTTTGTGGTGCGTGGGGCTGGGGCCTACATCTGTGGAGAAGAG
ACGGCACTTATTGAATCCATTGAAGGCAAGCAGGGAAAGCCACGCCTGAAGCCGCCCTTT
CCAGCAGATGTGGGAGTGTTTGGATGCCCCACAACTGTGGCCAATGTGGAGACAGTGGCT
GTGTCCCCCACCATTTGCCGTCGTGGGGGCACCTGGTTTGCTGGCTTTGGCCGAGAACGC
AATTCAGGTACCAAATTGTTTAACATCTCTGGCCATGTCAACCACCCCTGCACTGTGGAG
GAAGAGATGTCTGTGCCACTGAAAGAGCTGATTGAGAAACATGCTGGTGGTGTCACAGGT
GGCTGGGACAACCTCCTTGCTGTGATTCCTGGTGGCTCATCTACTCCACTGATTCCCAAA
TCTGTGTGTGAGACCGTGCTAATGGACTTCGATGCACTGGTGCAGGCTCAGACAGGCCTG
GGCACGGCTGCAGTTATTGTTATGGATCGCTCGACAGACATTGTGAAAGCCATCGCTCGT
CTCATTGAGTTCTACAAGCATGAGAGCTGTGGCCAGTGTACCCCGTGCCGTGAGGGCGTT
GACTGGATGAACAAGGTGATGGCCCGATTTGTGAAGGGAGATGCCCGGCCAGCTGAGATT
GACTCCCTGTGGGAGATCAGCAAGCAGATAGAAGGCCACACCATTTGTGCTCTGGGTGAT
GGGGCTGCCTGGCCAGTACAGGGTCTGATCCGACATTTCAGGCCAGAGCTTGAGGATCGG
ATGCAACGGTTTGCCCAGCAGCACCGGGCCTGGCAGGCAGCCTCGTGACGGGACTTAATT
AACTCTAGATAACTG

Protein sequence predicted based on nucleotide sequence

MLAARHFLGGLVPVRVSVRFSSGTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGALRRG
DWYKTKEILLKGPDWILGEMKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREIMRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSDYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEDRMQRFAQQHRAWQAAS*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
ATGGGATCTGATAAAATTCATCATCATCATCATCAC
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
ProteinExpressed: Not_Applicable
ProteinPurified: Protein_Purified
SolubleProtein: Tested_Not_Soluble
Find experimental protocols in 354818
Recommended expression in:
Not Applicable