BC3029 (B. cereus )
In pET21_NESG (His-tagged bacterial expression vector)

Explanation of Terms

Gene:
Gene Symbol:  BC3029
Gene Name:  hypothetical protein
Original Clone ID:
BcR114-21.1
Keyword:
None
Species:
Bacillus cereus
Type:
cDNA
Vector Name:
pET21_NESG
Format: 
FUSION
Source:
Northeast Structural Genomics Consortium
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
PSI
Northeast Structural Genomics Consortium
BcCD00385013
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI/NESG
Insert sequence: 789nts
Open reading frame: 51 to 839

ATAATTTTGTTTAACTTTAAGAAGGAGATATACATATGGCGGGGGATCCGATGGAAACGT
TATTAATCCAGCAAACTGAGAAATCAAATAAGTTTTGGAAAATCGTTGTGAAAGAAAAAG
ACTATGTTGTGTTTTACGGAAAAATTGGCACAGCTGGCAGTGTGAAAGCGAAAGAGTTTG
AAACAGAAGAAGAATGTATGAATGAAGCTAATAAACTAGTTGCTTCCAAACGTAAAAAAG
GATATATAGACCCGTTGCCTGGGGAAGATTACATAAAAGAAAAAACGATAACCGAAGAAG
AATTTTGGGAGCTACTTCATCGTGCAAAAACGAAAGGTGAGGACCAAGAAGAACAAATAG
AATGGCTTACTTCTCACCTTGCTAAACGTACAGTACATGAAATTGTAGCTTTTGATACGC
ATATGCATAGCCTTTTGAAAGACTCCTATACCTCCCGTTTATGGGCAGCAGCCTATATTA
TTATGGGTGGCTGTTCAGATGATACTTTCGATTACTTCCGCGGATGGTTATTATATCAAG
GAAAAGAGACATACGAAGCTTGTATTGAAGATCCAGAACGATTAATTCCTGTATTAGAAA
ATTTGAGTGAGTATGACGTCCCAGAAATAGAAGAACTTTCTTTATATTTCGGTTTCACTG
TATATGCAGAAAAAACTGGTGACGAAGATGATACTTACTTTACACTTTACCATGTCTTAT
CTAATGAAGAATTCGACGATGTAGATTTTGAATTTGACTGGAATGAAGACGATGAAGAAG
GTTTAAAAAAGGTGTTTCCTAGGCTATGGGAGATGTATGGGGAAGAACCGATTGAGTGGC
TCGAGCACCACCACCACCACCACTGAGATCCGGCT

Protein sequence predicted based on nucleotide sequence

METLLIQQTEKSNKFWKIVVKEKDYVVFYGKIGTAGSVKAKEFETEEECMNEANKLVASK
RKKGYIDPLPGEDYIKEKTITEEEFWELLHRAKTKGEDQEEQIEWLTSHLAKRTVHEIVA
FDTHMHSLLKDSYTSRLWAAAYIIMGGCSDDTFDYFRGWLLYQGKETYEACIEDPERLIP
VLENLSEYDVPEIEELSLYFGFTVYAEKTGDEDDTYFTLYHVLSNEEFDDVDFEFDWNED
DEEGLKKVFPRLWEMYGEEPIEW

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
AAGGAGATATACATATGGCGGGGGATCCg
3' Linker Sequence:
CTCGAGCACCACCACCACCACCACTGA

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
ProteinPurified: Protein_Purified
SolubleProtein: Protein_Soluble
Find experimental protocols in BcR114
Recommended expression in:
Not Applicable