TSPO (H. sapiens )
In pET16b (His tagged bacterial expression vector)

Explanation of Terms

Gene:
Gene Symbol:  TSPO
Gene Name:  translocator protein (18kDa)
Original Clone ID:
MPSbyNMR-001
Keyword:
None
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pET16b
Format: 
CLOSED
Source:
Membrane Protein Structures by Solution NMR
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
Harvard Medical School
James Chou Lab
PSI:Biology
Membrane Protein Structures by Solution NMR
HsCD00433655
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 537nts
Open reading frame: 1 to 537

ATGGGCCATCATCACCATCATCACGGCGGCGCTCCTCCTTGGGTTCCTGCTATGGGTTTT
ACTTTGGCTCCTTCTTTGGGTTGTTTTGTTGGTTCTCGTTTTGTTCATGGTGAGGGTTTG
CGTTGGTATGCTGGTTTGCAGAAGCCTTCTTGGCATCCTCCTCATTGGGTTTTGGGTCCT
GTTTGGGGTACTTTGTATTCTGCTATGGGTTATGGTTCTTATTTGGTTTGGAAGGAGTTG
GGTGGTTTTACTGAGAAGGCTGTTGTTCCTTTGGGTTTGTATACTGGTCAGTTGGCTTTG
AATTGGGCTTGGCCTCCTATTTTTTTTGGTGCTCGTCAGATGGGTTGGGCTTTGGTTGAT
TTGTTGTTGGTTTCTGGTGCTGCTGCTGCTACTACTGTTGCTTGGTATCAGGTTTCTCCT
TTGGCTGCTCGTTTGTTGTATCCTTATTTGGCTTGGTTGGCTTTTGCTACTACTTTGAAT
TATTGTGTTTGGCGTGATAATCATGGTTGGCATGGTGGTCGTCGTTTGCCTGAGTGA

Protein sequence predicted based on nucleotide sequence

MGHHHHHHGGAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGP
VWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVD
LLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
CATATG
3' Linker Sequence:
ATGGGC

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
SolubleProtein: Not_applicable
ProteinExpressed: Protein_Confirmed
ProteinPurified: Protein_purified
Find experimental protocols in MPSbyNMR-001
Recommended expression in:
Not Applicable