pbg1 (L. plantarum WCFS1 )
In pMCSG7 (His-tagged bacterial expression vector)

Explanation of Terms

Gene:
Gene Symbol:  pbg1
Gene Name:  6-phospho-beta-glucosidase
Original Clone ID:
APC100114.102
Keyword:
None
Species:
Lactobacillus plantarum WCFS1
Type:
cDNA
Vector Name:
pMCSG7
Format: 
CLOSED
Source:
Midwest Center for Structural Genomics
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
PMID: 23519420
Title: GH1-family 6-P-Beta-glucosidases from human microbiome lactic acid bacteria.
Authors:
Jessica Bearden
PSI:Biology
Midwest Center for Structural Genomics
LpCD00454237
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 1437nts
Open reading frame: 44 to 1480

TGTAGATCTGGGTACCGAGAACCTGTACTTCCAATCCAATGCCATGACGATTAAAGGACG
AGCGTTTCCAGAAGGGTTCTTATGGGGTGGCGCAGTGGCTGCACATCAACTCGAAGGTGG
TTATAAAGAGGGCGGCAAGGGTCTCAGTACGGCAGATATTATGACATTAGGGACGAATGA
GCGCCCTCGTGAAATTACGGACGGAGTAGTGGCTGGCAAGTATTATCCTAATCATCAGGC
AATTGATTTTTATCATCGTTATCCCGAAGATATTGAATTATTTGCTGAAATGGGGTTTAA
GTGTTTTCGAACATCGATTGCCTGGACGCGGATCTTCCCCAATGGTGATGAAAGCGAACC
GAATGAAGCTGGATTACAATTTTATGATGATTTATTTGATGAATGCCTTAAAAATGGGAT
TCAACCAGTAGTGACACTAGCACACTTTGAAATGCCATATCACTTAGTTAAGCAATACGG
TGGGTGGCGTAATCGTAAGCTTATTCAATTCTATTTAAACTTTGCAAAAGTATGTTTTGA
ACGTTATCGAGATAAAGTAACGTACTGGATGACTTTTAATGAAATCAACAATCAAACTAA
TTTTGAATCAGACGGTGCCATGTTAACAGATTCTGGAATCATTCATCAACCAGGAGAAAA
CCGTGAACGCTGGATGTATCAGGCGGCTCACTATGAACTGGTGGCGAGTGCCGCGGCGGT
ACAGTTAGGCCATCAGATTAATCCAGATTTTCAAATCGGTTGTATGATTGCGATGTGTCC
GATCTATCCGCTTACAGCAGCACCAGCAGACGTCTTATTTGCGCAACGAGCGATGCAAAC
CCGATTTTATTTTGCCGATGTTCATTGCAATGGCACTTACCCACAATGGTTGCGTAATCG
TTTTGAGTCGGAGCATTTTAACTTGGACATTACGGCAGAAGATTTGAAAATCTTGCAAGC
TGGAACGGTAGATTATATTGGATTTAGCTATTACATGTCGTTTACTGTGAAGGACACAGG
AAAGCTAGCTTATAATGAAGAACATGATTTAGTTAAAAATCCATATGTTAAGGCTAGTGA
TTGGGGCTGGCAAGTTGATCCCGTTGGGTTACGCTATGCTATGAATTGGTTCACGGATCG
TTACCATTTGCCACTGTTTATCGTGGAAAACGGTTTAGGCGCAATTGATAAGAAGACGGC
AGATAACCAGATACATGACGATTATCGGATTGACTATTTAACGGATCATTTACGACAAAT
TAAGCTGGCAGTTCTGGAAGATGGGGTTGATTTAATTGGGTATACGCCATGGGGGTGCAT
TGATTTAGTTGCGGCTAGTACTGGTCAAATGTCCAAACGCTATGGGTTTATCTATGTTGA
TGAGAACGATGATGGTTCAGGTAGTCTAAAACGTTATAAAAAGGATTCATTTACTTGGTT
TCAACATGTGATTGCGACAAATGGTGCCGAAATTGAGTAGTAACATTGGAAGTGGATAAC
GGATCCGAATTCGAGCTCCG

Protein sequence predicted based on nucleotide sequence

MTIKGRAFPEGFLWGGAVAAHQLEGGYKEGGKGLSTADIMTLGTNERPREITDGVVAGKY
YPNHQAIDFYHRYPEDIELFAEMGFKCFRTSIAWTRIFPNGDESEPNEAGLQFYDDLFDE
CLKNGIQPVVTLAHFEMPYHLVKQYGGWRNRKLIQFYLNFAKVCFERYRDKVTYWMTFNE
INNQTNFESDGAMLTDSGIIHQPGENRERWMYQAAHYELVASAAAVQLGHQINPDFQIGC
MIAMCPIYPLTAAPADVLFAQRAMQTRFYFADVHCNGTYPQWLRNRFESEHFNLDITAED
LKILQAGTVDYIGFSYYMSFTVKDTGKLAYNEEHDLVKNPYVKASDWGWQVDPVGLRYAM
NWFTDRYHLPLFIVENGLGAIDKKTADNQIHDDYRIDYLTDHLRQIKLAVLEDGVDLIGY
TPWGCIDLVAASTGQMSKRYGFIYVDENDDGSGSLKRYKKDSFTWFQHVIATNGAEIE*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
ProteinPurified: Protein_Purified
SolubleProtein: Protein_Soluble
Find experimental protocols in MCSG-APC100114
Recommended expression in:
Not Applicable