NANOG (Homo sapiens) in pSpeedET (bacterial expression vector)

Explanation of Terms

Gene:
Gene Symbol:  NANOG
Gene Name:  Nanog homeobox
Original Clone ID:
99166
Keyword:
None
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pSpeedET
Format: 
CLOSED
Source:
Joint Center for Structural Genomics
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
PSI:Biology
Joint Center for Structural Genomics
HsCD00547784
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 918nts
Open reading frame: 51 to 968

CTGATAAAATTCATCATCATCATCATCACGAAAACCTGTACTTCCAGGGCATGAGTGTGG
ATCCAGCTTGTCCCCAAAGCTTGCCTTGCTTTGAAGCATCCGACTGTAAAGAATCTTCAC
CTATGCCTGTGATTTGTGGGCCTGAAGAAAACTATCCATCCTTGCAAATGTCTTCTGCTG
AGATGCCTCACACGGAGACTGTCTCTCCTCTTCCTTCCTCCATGGATCTGCTTATTCAGG
ACAGCCCTGATTCTTCCACCAGTCCCAAAGGCAAACAACCCACTTCTGCAGAGAAGAGTG
TCGCAAAAAAGGAAGACAAGGTCCCGGTCAAGAAACAGAAGACCAGAACTGTGTTCTCTT
CCACCCAGCTGTGTGTACTCAATGATAGATTTCAGAGACAGAAATACCTCAGCCTCCAGC
AGATGCAAGAACTCTCCAACATCCTGAACCTCAGCTACAAACAGGTGAAGACCTGGTTCC
AGAACCAGAGAATGAAATCTAAGAGGTGGCAGAAAAACAACTGGCCGAAGAATAGCAATG
GTGTGACGCAGAAGGCCTCAGCACCTACCTACCCCAGCCTTTACTCTTCCTACCACCAGG
GATGCCTGGTGAACCCGACTGGGAACCTTCCAATGTGGAGCAACCAGACCTGGAACAATT
CAACCTGGAGCAACCAGACCCAGAACATCCAGTCCTGGAGCAACCACTCCTGGAACACTC
AGACCTGGTGCACCCAATCCTGGAACAATCAGGCCTGGAACAGTCCCTTCTATAACTGTG
GAGAGGAATCTCTGCAGTCCTGCATGCAGTTCCAGCCAAATTCTCCTGCCAGTGACTTGG
AGGCTGCCTTGGAAGCTGCTGGGGAAGGCCTTAATGTAATACAGCAGACCACTAGGTATT
TTAGTACTCCACAAACCATGGATTTATTCCTAAACTACTCCATGAACATGCAACCTGAAG
ACGTGTAACGCGACTTAATTAATTTGGCGGATGAGAGAAGATTTTCAGCCTGATAC

Protein sequence predicted based on nucleotide sequence

MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDL
LIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYL
SLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSS
YHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPF
YNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNM
QPEDV*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
ATGGGATCTGATAAAATTCATCATCATCATCATCACGAAAACCTGTACTTCCAGGGC
3' Linker Sequence:
TAA

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: 50ug/mL kanamycin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Conditions for Gateway-type vectors in recombined (with insert) form and other kanamycin resistant vectors.
Protein Expression Results:
ProteinExpressed: Not_Applicable
ProteinPurified: Not_Applicable
SolubleProtein: Not_Applicable
Find experimental protocols in 423216
Recommended expression in:
Not Applicable