SOX2 (Homo sapiens) in pET15Nano6HT_NESG

Explanation of Terms

Gene:
Gene Symbol:  SOX2
Gene Name:  SRY (sex determining region Y)-box 2
Original Clone ID:
HR8317A-38-121-TEV.1
Keyword:
targeted domain
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pET15Nano6HT_NESG
Format: 
CLOSED
Source:
Northeast Structural Genomics Consortium
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
Rutgers University
PSI:Biology
Northeast Structural Genomics Consortium
HsCD00651403
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI/NESG
Insert sequence: 255nts
Open reading frame: 10 to 264

AGCCATATGCCGGACCGCGTCAAGCGGCCCATGAATGCCTTCATGGTGTGGTCCCGCGGG
CAGCGGCGCAAGATGGCCCAGGAGAACCCCAAGATGCACAACTCGGAGATCAGCAAGCGC
CTGGGCGCCGAGTGGAAACTTTTGTCGGAGACGGAGAAGCGGCCGTTCATCGACGAGGCT
AAGCGGCTGCGAGCGCTGCACATGAAGGAGCACCCGGATTATAAATACCGGCCCCGGCGG
AAAACCAAGACGCTCATGAAGTAG

Protein sequence predicted based on nucleotide sequence

PDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRL
RALHMKEHPDYKYRPRRKTKTLMK*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
ATGGACGTTGAAGCTTGGCTGGACGAACGTGTTCCGCTGGTTGAAACCCA TCACCATCACCATCACGAAAACCTGTATTTTCAGAGCCATATG
3' Linker Sequence:
CTCGAGATCCGG

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
ProteinPurified: Not_Tested
ProteinExpressed: Protein_Confirmed
SolubleProtein: Protein_Soluble
Find experimental protocols in HR8317A
Recommended expression in:
Not Applicable