KMT2A (Homo sapiens) in pET15Avi6HT_NESG

Explanation of Terms

Gene:
Gene Symbol:  KMT2A
Gene Name:  lysine (K)-specific methyltransferase 2A
Original Clone ID:
None
Keyword:
targeted domain
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pET15Avi6HT_NESG
Format: 
CLOSED
Source:
Rutgers University
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
Stephen Anderson
Elliot Campbell
Rutgers University
Protein Capture Reagents Program
HsCD00651945
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: SPTA
Insert sequence: 348nts
Open reading frame: 1 to 348

GCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATT
GATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGAC
AAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGAC
TCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGT
GAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTT
GCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATTAG

Protein sequence predicted based on nucleotide sequence

AVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDD
SEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDY*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
ATGTCTGGTCTGAACGACATCTTCGAAGCTCAGAAAATCGAATGGCACGA ACATCACCATCACCATCACGAAAACCTGTATTTTCAGAGCCATATG
3' Linker Sequence:
CTCGAGATCCGG

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
None
Recommended expression in:
Not Applicable