HAND2 (Homo sapiens) in P2RP3

Explanation of Terms

Gene:
Gene Symbol:  HAND2
Gene Name:  heart and neural crest derivatives expressed 2
Original Clone ID:
None
Keyword:
Sequence Verified: Yes; 3'UTR length: 956; Forward Primer: CTGGAGCTCAAGCAGTGA; Reverse Primer: GGAAGGAGACACCACACCGA
Species:
Homo sapiens
Type:
3'UTR
Vector Name:
P2RP3
Format: 
None
Source:
Center for Personalized Diagnostics
Description:
Please cite: Kotagama, K., Babb, C.S., Wolter, J.M., Murphy, R.P. and Mangone, M. "A human 3'UTR clone collection to study post-transcriptional gene regulation". BMC Genomics 16, 1036 (2015).
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
PMID: 26645212
Title: A human 3'UTR clone collection to study post-transcriptional gene regulation
Authors:
Center for Personalized Diagnostics
Marco Mangone
Kasuen Kotagama
HsUT00699131
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: None
Insert sequence: 957nts
Open reading frame: 1 to 957

CACGTCTGGGCCCTGGAGCTCAAGCAGTGAGGAGGAGGAGAAGGAGGAGGAGGAGAGCGC
GAGTGAGCAGGGGCCAAGGCGCCAGATGCAGACCCAGGACTCCGGAAAAGCCGTCCGCGC
TCCGCTCTGAGGACTCCTTGCATTTGGAATCATCCGGTTTATTTATGTGCAATTTCCTTC
CCCTCTCTTTGACCCCCTTTGAGGCATCTGCTCCCCGTCTCCCCCTCCAAAAAAAAAGTG
GATATTTGAAGAAAAGCATTCCATATTTTAATACGAAGAGGACACTCCCGTGTGGTAAGG
GATCCCGTCGTCTCATAGATTCTGTGTGCGTGAATGTTCCCTCTTGGCTGTGTAGACACC
AGCGTTGCCCCCCGCCAACCTACTCAACCCCTTCCAGATAAAGACAGTGGGCACTAGTGC
GTTTGTGAAGTGTATCTTTAATACTTGGCCTTTGGATATAAATATTCCTGGGTATTATAA
AGTTTTATTTCAAAGCAGAAAACAGGGCCGCTAACATTTCCGTTGGGGTCGGTATCTAGT
GCTATCCATTCATCTGTGGTCGTTCCCTCTTTGAAGATGTTTCCAACAGCCACTTGTTTT
GTGCACTTCCGTCCTCTAAAACTAAATGGAATTTAATTAATATTGAAGGTGTAAACGTTG
TAAGTATTCAATAAACCACTGTGTTTTTTTTTTACAAAAACCTTAATCTTTTAATGGCTG
ATACCTCAAAAGAGTTTTGAAAACAAAGCTGTTATACTTGTTTTCGTAATATTTAAAATA
TTCAGAAGTAAACTAAATTATCATGATTGCCTCTAACTTTATTTTAAAGACTCAGTGGTT
CCAACCAGTCACCCTGACCTGCGGCCTACGCAGGAGGAGGAGGTGCTCTTAAAGAGAAGT
GTCCTTGTTACAAATCCTGCAAATGGTCTGGGGTTTGTCGGTGTGGTGTCTCCTTCC

Protein sequence predicted based on nucleotide sequence

HVWALELKQ*GGGEGGGGERE*AGAKAPDADPGLRKSRPRSALRTPCIWNHPVYLCAISF
PSL*PPLRHLLPVSPSKKKVDI*RKAFHILIRRGHSRVVRDPVVS*ILCA*MFPLGCVDT
SVAPRQPTQPLPDKDSGH*CVCEVYL*YLAFGYKYSWVL*SFISKQKTGPLTFPLGSVSS
AIHSSVVVPSLKMFPTATCFVHFRPLKLNGI*LILKV*TL*VFNKPLCFFFTKTLIF*WL
IPQKSFENKAVILVFVIFKIFRSKLNYHDCL*LYFKDSVVPTSHPDLRPTQEEEVLLKRS
VLVTNPANGLGFVGVVSPS

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: kanamycin
Growth Condition: Growth in 50 ug/ml of kanamycin in LB at 37 degrees
Comments: None
Protein Expression Results:
None
Recommended expression in:
Not Applicable