GSC (Homo sapiens) in pJFT7_nHalo_DC(r4)

Explanation of Terms

Gene:
Gene Symbol:  GSC
Gene Name:  goosecoid homeobox
Original Clone ID:
None
Keyword:
None
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pJFT7_nHalo_DC(r4)
Format: 
CLOSED (STOP codon in vector)
Source:
Center for Personalized Diagnostics
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
Center for Personalized Diagnostics
HsCD00779339
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: None
Insert sequence: 771nts
Open reading frame: 1 to 771

ATGCCCGCCAGCATGTTCAGCATCGACAACATCCTAGCCGCCCGGCCGCGCTGCAAGGAC
TCGGTGTTGCCGGTGGCGCACAGCGCGGCGGCTCCCGTCGTCTTCCCGGCCCTGCACGGG
GACTCGCTCTACGGCGCCAGCGGCGGCGCCTCCTCGGACTATGGCGCCTTCTACCCGCGC
CCCGTGGCCCCCGGCGGCGCGGGCCTCCCGGCCGCGGTCAGCGGCTCCCGCCTCGGCTAC
AACAACTACTTCTACGGGCAGCTGCACGTGCAGGCGGCGCCCGTGGGCCCGGCCTGCTGC
GGGGCCGTGCCGCCGCTGGGCGCCCAGCAGTGCTCCTGCGTCCCGACGCCCCCAGGCTAC
GAGGGCCCCGGTTCGGTGCTGGTGTCCCCGGTACCGCACCAGATGCTGCCCTACATGAAC
GTGGGCACGCTGTCGCGCACCGAGCTGCAGCTTCTCAACCAGCTGCACTGTCGGCGGAAG
CGGCGGCACCGCACCATCTTCACTGACGAGCAGCTCGAAGCTCTCGAGAACCTCTTCCAG
GAGACCAAGTACCCGGACGTGGGCACGCGCGAGCAGCTGGCCCGGAAAGTGCACCTCCGC
GAGGAGAAAGTGGAGGTCTGGTTTAAGAACCGCCGCGCCAAATGGAGGCGGCAGAAGCGG
TCCTCATCAGAGGAGTCGGAGAACGCGGAGAAGTGGAACAAGACGTCGTCGTCGAAGGCG
TCACCGGAGAAGAGGGAAGAGGAAGGTAAAAGCGATTTGGACTCGGACAGC

Protein sequence predicted based on nucleotide sequence

MPASMFSIDNILAARPRCKDSVLPVAHSAAAPVVFPALHGDSLYGASGGASSDYGAFYPR
PVAPGGAGLPAAVSGSRLGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGY
EGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQ
ETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKA
SPEKREEEGKSDLDSDS

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
None
Recommended expression in:
Not Applicable