Detailed Plasmid Information

Explanation of Terms

Gene:
Gene Symbol: 
Gene Name:  None
Original Clone ID:
13236
Keyword:
None
Species:
Thermotoga maritima
Type:
cDNA
Vector Name:
pMH4
Format: 
CLOSED
Source:
Joint Center for Structural Genomics
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
PMID: 23226342
Title: Functional characterization of two M42 aminopeptidases erroneously annotated as cellulases
Authors:
PSI
Joint Center for Structural Genomics
TmCD00089984
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 996nts
Open reading frame: 51 to 1046

AGATATACATACCCATGGGATCTGATAAAATTCATCATCATCATCATCACATGAAGGAAC
TGATCAGAAAGCTGACGGAAGCCTTCGGCCCAAGTGGACGGGAAGAAGAGGTGAGAAGTA
TCATCCTCGAGGAACTCGAAGGGCACATAGATGGCCACAGGATCGATGGGCTCGGCAATC
TCATTGTCTGGAAAGGAAGCGGCGAGAAAAAGGTGATACTGGACGCTCACATAGATGAGA
TAGGTGTTGTCGTCACAAACGTGGACGACAAGGGATTTCTGACAATAGAACCCGTCGGCG
GTGTCTCTCCGTACATGCTTCTTGGAAAAAGGATCAGGTTCGAAAACGGTACAATAGGCG
TTGTTGGTATGGAAGGTGAAACAACAGAAGAAAGGCAGGAGAATGTGAGAAAGCTCTCGT
TCGACAAGCTGTTCATCGATATCGGTGCAAATTCCAGAGAAGAAGCACAGAAGATGTGCC
CAATTGGAAGCTTCGGTGTCTACGACAGTGGATTCGTCGAAGTTTCCGGGAAATACGTCT
CGAAGGCGATGGATGACAGGATAGGATGTGCCGTGATCGTGGAAGTTTTCAAAAGAATCA
AACCCGCTGTTACGCTCTACGGTGTTTTCAGTGTTCAGGAAGAAGTGGGACTGGTCGGTG
CCTCGGTGGCGGGGTACGGCGTACCAGCGGACGAGGCCATCGCGATCGATGTGACTGATT
CGGCAGACACTCCGAAGGCCATCAAGAGACACGCAATGAGGCTCTCCGGTGGACCCGCTC
TGAAAGTGAAAGACAGGGCATCGATCAGCAGCAAACGCATCCTCGAAAATTTGATAGAAA
TCGCGGAAAAATTCGATATAAAGTATCAGATGGAGGTTCTGACGTTCGGCGGTACGAACG
CCATGGGGTACCAGCGGACTAGAGAAGGGATTCCTTCGGCCACGGTGTCTATTCCCACAC
GATACGTTCACTCACCCAGTGAGATGATCGCACCAGATGATGTTGAGGCAACGGTCGATC
TTCTCATCAGGTATCTGGGGGCGTAACGCGACTTAATTAACTCTAGATAACTGAGAAGGA
GATATACATACCCGGG

Protein sequence predicted based on nucleotide sequence

MKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAH
IDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVR
KLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVF
KRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSG
GPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVS
IPTRYVHSPSEMIAPDDVEATVDLLIRYLGA*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Reference Sequence Annotations:
Start on reference sequence 1
End on reference sequence 1046
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
ProteinPurified: Protein_Purified
SolubleProtein: Protein_Soluble
Find experimental protocols in 282917
Recommended expression in:
Not Applicable