TOP1 (S. cerevisiae ) in pBY011 (yeast expression vector)

Explanation of Terms

Gene:
Gene Symbol:  TOP1
Gene Name:  topoisomerase I
Original Clone ID:
FLH259915.01X
Keyword:
None
Species:
Saccharomyces cerevisiae
Type:
cDNA
Vector Name:
pBY011
Format: 
CLOSED
Source:
HIP
Description:
None
Comments:
None
Mutation / Discrepancy:
No / Yes
Publications:
None
Authors:
ScCD00096248
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: None
Insert sequence: 2310nts
Open reading frame: 1 to 2310

ATGACTATTGCTGATGCTTCCAAAGTTAATCATGAGTTGTCTTCTGATGACGATGACGAT
GTGCCATTATCTCAAACTTTAAAAAAAAGAAAGGTGGCGTCCATGAACTCTGCCTCTCTT
CAAGACGAAGCGGAACCTTATGATAGTGATGAGGCAATCTCTAAGATTTCCAAGAAAAAG
ACTAATAAAATAAAGACCGAACCAGTGCAATCGTCGTCATTACCATCGCCTCCAGCAAAG
AAAAGCGCGACATCAAAGCCTAAAAAAATCAAGAAAGAAGATGGTGATGTAAAGGTAAAA
ACAACTAAAAAGGAAGAACAGGAGAACGAAAAAAAGAAACGAGAAGAAGAAGAAGAGGAG
GACAAGAAAGCGAAGGAGGAGGAGGAAGAATATAAATGGTGGGAAAAAGAAAACGAAGAT
GACACCATAAAATGGGTCACACTGAAGCATAACGGTGTTATATTCCCTCCACCATACCAG
CCCTTACCATCTCACATCAAATTATATTACGATGGGAAGCCAGTAGATTTACCTCCGCAA
GCTGAAGAAGTAGCCGGGTTCTTTGCTGCCCTATTAGAGAGTGATCATGCCAAAAATCCT
GTTTTCCAAAAGAACTTCTTCAATGATTTCTTGCAAGTACTGAAAGAAAGTGGTGGTCCC
CTCAATGGAATTGAGATAAAGGAATTTTCTCGTTGCGATTTCACCAAAATGTTTGATTAC
TTCCAGTTACAAAAAGAACAGAAAAAGCAACTGACTTCCCAAGAAAAGAAACAGATTCGT
TTGGAAAGAGAAAAATTCGAGGAAGATTATAAATTCTGTGAATTAGATGGCAGAAGGGAA
CAAGTAGGGAATTTCAAGGTTGAACCTCCTGATCTATTTAGAGGTCGTGGCGCTCACCCA
AAAACAGGCAAATTGAAGAGAAGAGTGAATCCTGAGGATATCGTTTTAAATCTAAGTAAA
GACGCACCCGTTCCGCCAGCCCCAGAAGGGCACAAGTGGGGTGAAATCAGACACGACAAT
ACCGTTCAATGGTTAGCCATGTGGAGAGAGAATATTTTCAACTCATTCAAATACGTCAGA
TTGGCAGCGAACTCTTCATTGAAGGGTCAAAGTGACTACAAGAAGTTTGAAAAGGCGAGA
CAATTGAAATCCTATATCGATGCCATCAGAAGGGATTACACGAGAAATTTGAAAAGCAAA
GTTATGCTAGAGCGCCAAAAGGCCGTAGCCATTTATTTGATCGATGTATTCGCTTTAAGA
GCCGGTGGTGAAAAATCCGAAGATGAAGCCGATACTGTGGGTTGTTGTTCATTGCGATAT
GAGCATGTTACTTTGAAACCTCCGAATACTGTTATCTTTGATTTCTTAGGTAAGGATTCT
ATTAGATTTTATCAAGAGGTAGAAGTTGACAAACAAGTTTTCAAAAATTTGACAATTTTT
AAAAGGCCGCCCAAACAGCCAGGACATCAACTGTTTGATCGTCTAGATCCATCTATACTG
AACAAATATCTACAAAACTACATGCCGGGATTGACTGCTAAAGTTTTCCGTACATATAAT
GCTTCCAAAACAATGCAAGATCAACTGGATCTAATTCCAAATAAAGGATCTGTCGCAGAG
AAAATATTGAAGTACAACGCAGCAAATAGAACTGTAGCCATCCTATGTAACCATCAAAGG
ACTGTCACGAAGGGGCATGCACAAACAGTGGAAAAGGCCAATAATAGAATACAAGAGTTG
GAATGGCAAAAGATTCGTTGCAAGAGGGCCATTTTACAATTGGATAAGGATCTTTTAAAG
AAAGAGCCAAAATATTTCGAAGAAATCGACGATTTGACGAAAGAAGATGAAGCCACCATT
CACAAGAGAATTATTGATAGAGAAATTGAAAAATATCAGCGAAAATTTGTTAGGGAGAAC
GATAAGAGGAAATTTGAAAAGGAAGAATTATTGCCGGAAAGTCAATTGAAGGAATGGTTG
GAGAAAGTCGACGAAAAGAAACAAGAATTCGAAAAGGAATTGAAAACCGGTGAAGTGGAA
CTGAAATCAAGTTGGAATTCAGTCGAAAAAATAAAAGCACAAGTAGAGAAATTAGAACAG
CGTATCCAAACTAGTTCCATTCAGTTGAAAGATAAAGAGGAAAACTCCCAGGTTTCACTG
GGCACTTCCAAAATCAATTATATAGACCCTAGACTTTCTGTGGTATTTTGCAAAAAGTAT
GATGTTCCGATTGAAAAGATTTTTACAAAAACCCTAAGAGAAAAATTCAAATGGGCCATA
GAATCGGTAGATGAAAATTGGAGGTTTTAG

Protein sequence predicted based on nucleotide sequence

MTIADASKVNHELSSDDDDDVPLSQTLKKRKVASMNSASLQDEAEPYDSDEAISKISKKK
TNKIKTEPVQSSSLPSPPAKKSATSKPKKIKKEDGDVKVKTTKKEEQENEKKKREEEEEE
DKKAKEEEEEYKWWEKENEDDTIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQ
AEEVAGFFAALLESDHAKNPVFQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDY
FQLQKEQKKQLTSQEKKQIRLEREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHP
KTGKLKRRVNPEDIVLNLSKDAPVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVR
LAANSSLKGQSDYKKFEKARQLKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALR
AGGEKSEDEADTVGCCSLRYEHVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIF
KRPPKQPGHQLFDRLDPSILNKYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAE
KILKYNAANRTVAILCNHQRTVTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLK
KEPKYFEEIDDLTKEDEATIHKRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWL
EKVDEKKQEFEKELKTGEVELKSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSL
GTSKINYIDPRLSVVFCKKYDVPIEKIFTKTLREKFKWAIESVDENWRF*

Coding Sequence Details

Insert Sequence Verified?:
N
Verification Method:
Insert was fully sequenced in parent vector
Reference Sequence Annotations:
Start on reference sequence 1
End on reference sequence 2310
Mutations:
None
Discrepancy:
g186t,K62N
                                                    

5' Linker Sequence:
5p GTACAAAAAAGCAGGCTCCACC(atg-goi)
3' Linker Sequence:
5p (goi-stop)GACCCAGCTTTCTTGTAC

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  yeast    Marker:  URA
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
None
Recommended expression in:
Not Applicable