SERPINB3 (H. sapiens )
In pMCSG7 (His-tagged bacterial expression vector)

Explanation of Terms

Gene:
Gene Symbol:  SERPINB3
Gene Name:  serpin peptidase inhibitor, clade B (ovalbumin), member 3
Original Clone ID:
NCI10350
Keyword:
None
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pMCSG7
Format: 
CLOSED
Source:
Argonne National Laboratory and National Cancer Institute Clinical Proteomic Technologies for Cancer
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
PMID: 24560885
Title: Psoriasis pathogenesis Pso p27 is generated from SCCA1 with chymase
Authors:
Argonne National Laboratory and National Cancer Institute Clinical Proteomic Technologies for Cancer
HsCD00343153
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: SPTA
Insert sequence: 1173nts
Open reading frame: 1 to 1173

ATGAATTCACTCAGTGAAGCCAACACCAAGTTCATGTTCGACCTGTTCCAACAGTTCAGA
AAATCAAAAGAGAACAACATCTTCTATTCCCCTATCAGCATCACATCAGCATTAGGGATG
GTCCTCTTAGGAGCCAAAGACAACACTGCACAACAGATTAAGAAGGTTCTTCACTTTGAT
CAAGTCACAGAGAACACCACAGGAAAAGCTGCAACATATCATGTTGATAGGTCAGGAAAT
GTTCATCACCAGTTTCAAAAGCTTCTGACTGAATTCAACAAATCCACTGATGCATATGAG
CTGAAGATCGCCAACAAGCTCTTCGGAGAAAAAACGTATCTATTTTTACAGGAATATTTA
GATGCCATCAAGAAATTTTACCAGACCAGTGTGGAATCTGTTGATTTTGCAAATGCTCCA
GAAGAAAGTCGAAAGAAGATTAACTCCTGGGTGGAAAGTCAAACGAATGAAAAAATTAAA
AACCTAATTCCTGAAGGTAATATTGGCAGCAATACCACATTGGTTCTTGTGAACGCAATC
TATTTCAAAGGGCAGTGGGAGAAGAAATTTAATAAAGAAGATACTAAAGAGGAAAAATTT
TGGCCAAACAAGAATACATACAAGTCCATACAGATGATGAGGCAATACACATCTTTTCAT
TTTGCCTCGCTGGAGGATGTACAGGCCAAGGTCCTGGAAATACCATACAAAGGCAAAGAT
CTAAGCATGATTGTGTTGCTGCCAAATGAAATCGATGGTCTCCAGAAGCTTGAAGAGAAA
CTCACTGCTGAGAAATTGATGGAATGGACAAGTTTGCAGAATATGAGAGAGACACGTGTC
GATTTACACTTACCTCGGTTCAAAGTGGAAGAGAGCTATGACCTCAAGGACACGTTGAGA
ACCATGGGAATGGTGGATATCTTCAATGGGGATGCAGACCTCTCAGGCATGACCGGGAGC
CGCGGTCTCGTGCTATCTGGAGTCCTACACAAGGCCTTTGTGGAGGTTACAGAGGAGGGA
GCAGAAGCTGCAGCTGCCACCGCTGTAGTAGGATTCGGATCATCACCTACTTCAACTAAT
GAAGAGTTCCATTGTAATCACCCTTTCCTATTCTTCATAAGGCAAAATAAGACCAACAGC
ATCCTCTTCTATGGCAGATTCTCATCCCCGTAG

Protein sequence predicted based on nucleotide sequence

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFD
QVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYL
DAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAI
YFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKD
LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLR
TMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTN
EEFHCNHPFLFFIRQNKTNSILFYGRFSSP*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
ProteinPurified: Protein_Confirmed
SolubleProtein: Protein_Confirmed
Recommended expression in:
Not Applicable