ULK3 (Homo sapiens) in pJP1563 (retroviral expression vector)

Explanation of Terms

Gene:
Gene Symbol:  ULK3
Gene Name:  unc-51 like kinase 3
Original Clone ID:
FLH214441.01L
Keyword:
None
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pJP1563
Format: 
FUSION
Source:
HIP
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
HsCD00039028
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: None
Insert sequence: 645nts
Open reading frame: 1 to 645

ATGGCGGGGCCCGGCTGGGGTCCCCCGCGCCTGGACGGCTTCATCCTCACCGAGCGCCTG
GGCAGCGGCACGTACGCCACGGTGTACAAGGCCTACGCCAAGAAGGACACTCGTGAAGTG
GTAGCCATAAAGTGTGTAGCCAAGAAAAGTCTGAACAAGGCATCGGTGGAGAACCTCCTC
ACGGAGATTGAGATCCTCAAGGGCATTCGACATCCCCACATTGTGCAGCTGAAAGACTTT
CAGTGGGACAGTGACAATATCTACCTCATCATGGAGTTTTGCGCAGGGGGCGACCTGTCT
CGCTTCATCCATACCCGCAGGATTCTGCCTGAGAAGGTGGCGCGTGTCTTCATGCAGCAA
TTAGCTAGCGCCCTGCAATTCCTGCATGAACGGAATATCTCTCACCTGGATCTGAAGCCA
CAGAACATTCTACTGAGCTCCTTGGAGAAGCCCCACCTAAAACTGGCAGACTTTGGTTTC
GCACAACACATGTCCCCGTGGGATGAGAAGCACGTGCTCCGTGGCTCCCCCCTCTACATG
GCCCCCGAGATGGTGTGCCAGCGGCAGTATGACGCCCGCGTGGACCTCTGGTCCATGGGG
GTCATCCTGTATGGTGAGACCTCTTTTCCCTGCTTCTCACCCTTG

Protein sequence predicted based on nucleotide sequence

MAGPGWGPPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLL
TEIEILKGIRHPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQ
LASALQFLHERNISHLDLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYM
APEMVCQRQYDARVDLWSMGVILYGETSFPCFSPL

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Insert was fully sequenced in parent vector; Verification by restriction enzyme digest
Reference Sequence Annotations:
Start on reference sequence 25
End on reference sequence 669
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Host Type:  mammalian    Marker:  blasticidin
Host Type:  bacterial    Marker:  chloramphenicol
Bacterial Selection Condition: 100 ug/mL ampicillin, 34 ug/mL chloramphenicol
Growth Condition: Growth with the double antibiotic in LB supplemented with 7% sucrose at 37 degrees is recommended.
Comments: Conditions for Creator-type vectors in with insert (recombined) form. Selection differs for the unrecombined, empty form of the vectors.
Protein Expression Results:
None
Recommended expression in:
Not Applicable