Detailed Plasmid Information

Explanation of Terms

Gene:
Gene Symbol: 
Gene Name: 
Original Clone ID:
11042e2BCt14p1
Keyword:
None
Species:
Sulfolobus solfataricus
Type:
cDNA
Vector Name:
pSGX3
Format: 
CLOSED
Source:
New York SGX Research Center for Structural Genomics
Description:
None
Comments:
Linker not verified.
Mutation / Discrepancy:
No / Yes
Publications:
None
Authors:
PSI
New York SGX Research Center for Structural Genomics
SsCD00531767
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 3510nts
Open reading frame: 51 to 3560

TCCCTCTGAAAATTTTGTTAACTTTAGAAGGAGATATACATATGTCCCTTAATGTAATGT
ATAAAAATTCCTGCCCTAACTGTGGTGGGGACATTTCTGGTGACAGATTGCTGAATGGTC
TGCCATGTGAGGCTTGTTTACCTTATATTAACGGAATAGATGATGTAGACCATATTTCAA
AGGTAAAAACGTTATACAATATTTTACTTAATAACGATAAAATTAAAAATTATTGGAATT
TATATTATAACATCACTACATTTGAAACTGTCTTTAAATATTTTAGAGATAAAACTGGAT
ATGAACCTTGGTCTCTCCAGAAACTATGGTTAAGAAGGCTTGCGAGTAATCAGAGTTTCA
CTATGTCAGCTCCAACTGGATTGGGGAAGACAACCACATTGATGACCTATTCTGTCTTTA
TTGGCCAAGATGTAGTATATATCGTTCCCACAAAGTCCTTAATGGAACAAGTATGTAAAA
GATTAGAGAAATTAGGTGCTCAAGTATCTTGTGGTAAAATTGATCAAAAGAAAGTAAGCG
TAATAACAATAAGTTACCTAAATAAGAACGCGGACTCGATAGTAAGCCTTAAGCCAAACT
TTGTCGTAATAGATGATGCAGATGCCGTAATAAAGAGCGGTAAAACAACTGATAGACTTG
TTAGCTTATTGGGGATTCCGAAGGACGTTTATGAGAGTGCGATTCAACTAATTAGGCTAA
GGAATAAATACTATTTCTCTAACGAATACACGGAAGAAGTTAAAGAAAAAATTAGAGAAT
TGGAGCTTAAGATAGCAGAATTTAAGGATAAAATTTCACAGCTAGTTATAGCTAGTGCTA
CAATACGACCTAAAGGCATTAAGCAAAAAGCTTTAAGGTTATTAACAGGTTTTGAACCTT
CTTCTATTCAGTTATATGCTAGGAATATAATTGATGCTTATACTGAAAATCTAGATCTTT
CAATAGTCAAGGAATTAGGAAGTGGTGGGTTAATTCTAGTTTCGAAAGAATATGGTAGGT
CCAAATTAAATGAAATAAAGAAATACGTTGAGGACTTAGGTTTTAACGCTAAATTAGCAA
TAAGTGGAAGGAAATTCCTCGACGATTTCTCTCAAGGTAAAGTAGATATTCTAGTAGGTT
CTGCGTCTTATTATGGTGTTGCCGTTAGAGGAATTGATGAACCTAAAAGATTAAAATACG
TCATATATTATGGAGTACCTAAAATAAGAGCTAAGCTTTTTGACGCTTTATCTAATCCAT
TTACATTACTCAGAGTAGGTAAATTAATTGGAATCGATTTTTCAAAGTTACAGAATAAGA
TTTTAATTCTGAATCCTTCTGAAGTTCAATTATTGAAGTTTTCCATAATAAAAGGAGAAA
GTATAAACTACCATAAGTTAGAACAATTGAGGCAAGAATTGCTATATTATATGTCATTAG
TTAAAGATAAGTTGAAGGAGAAAGTCGAGGATACTTTAATTTCAGATAGTTTTGTAATTA
CCAAGCAAAATGGAAATTATTATATCGTCTATCCCGATATGATAACATATTTGCAAGGCT
CTGGGAGGGCAAGCAGACTTTACAATGGTGGATTGACTCTTGGATTTTCAATAATTCTAG
TAGATGATAGACACATCTTTGAAATATTGGAGAAGAAAATGCAAAAATTGTTTCCTAACA
CTACCTTTACTTCATTATCTAATACAAATTTATCTGAAATAAAAATTAAACTGGAAGACT
CTAGAAAAGAAGAAGGGAATAGGGTCCATTTTAACATATCAACTGGTTTACTTATAGTAG
AGTCTCCAACAAAAGCAAAGACTATAGCTAAAATGTTTAGCAGACCCTCGGTTAGGATAA
GAAATAAAGTACCAGTATACGAAACCATTATAGTAGATGGTAATCAAATATACGTGTTAG
ATATAGTAGCTTCAAAAGGCCATATCGTGGATCTAACCTTAGAAGATATAGGATATTATG
GGATAAAAGTAGAAGATGATGGAACTATAAAGCCATATTACGACTTAATAAAGAAATGCC
TCGACTGTAATAAGATATTTTCTAGTGCTTCAGATAAATGTCCATACTGTGGTTCTGCAA
ATCTTCAATCAGCTCAAACTACCATTAACTTACTCAGGGAGTTAGCGTTATCAGTAGATA
AAGTGTTTATAGCTTCTGACCCAGATACTGAAGGGGAGAAGATAGCATATGATCTGGCTT
CATTCTTGTCTCCATATAATTCCAACGTGTATAGAGTAGTATATCACGAAATTACTAAGA
AGGCAATATTAGAGGCATTGAGGAATCCCAAAAAGATTAATACAAATCTAGTAATGAGTC
AGATAGTTAGAAGGATAGAAGATAGATGGATTGGCTTCACGTTAAGTAACTTACTAAAAA
CGAAGTTTAATGGACATAATCATGGTGCGGGTAGGGTACAAACTCCAGTTTTAGGTTGGA
TAGTGAATAAAACGATAAAGTATAAGAGTGCAATGGGTCACGTGGTTTATATTGACATCG
CGGGATACTCCATTAAAAAATATTTTAGTGAAAAAAGGAAGGTAGAAGAGTATATAAATA
ACTTACAAGTAGCTAGAATTGAAAAAATCTCTGAAGAGAAAATACTATTATCTCCATTAC
CTCCCTTTACTACAGACACCTTACTTATTGAGGCTAACATGAAATATAAACTACCAGCTA
ATCTTGTAATGAAGATTGCTCAAGATCTATTTGAGGCTGGCCTAATAACATATCATAGAA
CTGATAGTACTCATATTTCCTCTGTAGGTATAGAAATAGCAAAGGAGTATCTTCAAAAGC
AAGCGCTCATTAAAGAGTTTGTTCCTAGATCATGGGAATCATCGGAGGAAGGTGCTCATG
AGGCAATAAGACCAACTAGAGCTATAGACGTTAACGAGTTAATTCAAGAAATAGAGGAGA
ATCCTTATAAGTATTCGATAAGGTTTAGTAAATTACACTTATTAATTTACGACTTAATAT
TCAAGCGATTTATAGCTAGTCAGATGTCCCATGCAGTTGGTACAAAAAGTAGGTATTTGA
TAAAGTTAGGCAAGGACGATAATGTCGATGTAGAATTGTTAAGTAATGCTGAAGGCGGAT
TTATTAAGGTATATCCAGTTAAGGTGTATAATTTACCTGTAGGTGAGATTCAACCTAAAG
TTAATATTACTAAGGGGTCAAGTGAACAATTGCTAAGTTACTCTGATGTGATATCATTAA
TGAAATCTAAGGGAATTGGAAGGCCTAGTACATATGCAAAAACTATAGAAAATCTAATGA
AGCATGGATATATAGTTAGCAGTAAAAGAAAGTCATATCTAATAGCAACAAACAGAGGTA
TCTCAGTATATCAATTTCTAAGCTCCAAATTCTACGATCTAGTTTCCGAAAGTACCACAT
CTAGATTAATGACAAAATTGGACGACATTGCACTAAGCAAGTTGAATGCTTCTACAGTGT
TATTAGAAATATTCAGCGAGATATCTACCTTAGTAAACCCTCTTAAGTCTGAGGAAGGGC
ATCATCACCATCACCACTGATCCGAATTCGAGCTCCGTCGACAAGCTTGCGGCCGCACTC
GAGCACCACCA

Protein sequence predicted based on nucleotide sequence

NVMYKNSCPNCGGDISGDRLLNGLPCEACLPYINGIDDVDHISKVKTLYNILLNNDKIKN
YWNLYYNITTFETVFKYFRDKTGYEPWSLQKLWLRRLASNQSFTMSAPTGLGKTTTLMTY
SVFIGQDVVYIVPTKSLMEQVCKRLEKLGAQVSCGKIDQKKVSVITISYLNKNADSIVSL
KPNFVVIDDADAVIKSGKTTDRLVSLLGIPKDVYESAIQLIRLRNKYYFSNEYTEEVKEK
IRELELKIAEFKDKISQLVIASATIRPKGIKQKALRLLTGFEPSSIQLYARNIIDAYTEN
LDLSIVKELGSGGLILVSKEYGRSKLNEIKKYVEDLGFNAKLAISGRKFLDDFSQGKVDI
LVGSASYYGVAVRGIDEPKRLKYVIYYGVPKIRAKLFDALSNPFTLLRVGKLIGIDFSKL
QNKILILNPSEVQLLKFSIIKGESINYHKLEQLRQELLYYMSLVKDKLKEKVEDTLISDS
FVITKQNGNYYIVYPDMITYLQGSGRASRLYNGGLTLGFSIILVDDRHIFEILEKKMQKL
FPNTTFTSLSNTNLSEIKIKLEDSRKEEGNRVHFNISTGLLIVESPTKAKTIAKMFSRPS
VRIRNKVPVYETIIVDGNQIYVLDIVASKGHIVDLTLEDIGYYGIKVEDDGTIKPYYDLI
KKCLDCNKIFSSASDKCPYCGSANLQSAQTTINLLRELALSVDKVFIASDPDTEGEKIAY
DLASFLSPYNSNVYRVVYHEITKKAILEALRNPKKINTNLVMSQIVRRIEDRWIGFTLSN
LLKTKFNGHNHGAGRVQTPVLGWIVNKTIKYKSAMGHVVYIDIAGYSIKKYFSEKRKVEE
YINNLQVARIEKISEEKILLSPLPPFTTDTLLIEANMKYKLPANLVMKIAQDLFEAGLIT
YHRTDSTHISSVGIEIAKEYLQKQALIKEFVPRSWESSEEGAHEAIRPTRAIDVNELIQE
IEENPYKYSIRFSKLHLLIYDLIFKRFIASQMSHAVGTKSRYLIKLGKDDNVDVELLSNA
EGGFIKVYPVKVYNLPVGEIQPKVNITKGSSEQLLSYSDVISLMKSKGIGRPSTYAKTIE
NLMKHGYIVSSKRKSYLIATNRGISVYQFLSSKFYDLVSESTTSRLMTKLDDIALSKLNA
STVLLEIFSEISTLVNPLKSEEGHHHHHH*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
g2514a,V838V
                                                    

5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: 50ug/mL kanamycin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Conditions for Gateway-type vectors in recombined (with insert) form and other kanamycin resistant vectors.
Protein Expression Results:
ProteinPurified: Not_Tested
ProteinExpressed: Protein_Confirmed
SolubleProtein: Tested_Not_Soluble
Find experimental protocols in NYSGXRC-11042e
Recommended expression in:
Not Applicable