Detailed Plasmid Information

Explanation of Terms

Gene:
Gene Symbol: 
Gene Name: 
Original Clone ID:
None
Keyword:
full length: Yes; antibiotic: Spectinomycin; Original position: 1-546
Species:
Measles virus strain Schwarz
Type:
cDNA
Vector Name:
pANT7_cGST
Format: 
FUSION
Source:
Center for Personalized Diagnostics
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
PMID: 26450993
Title: Immunoproteomic Profiling of Antiviral Antibodies in New-Onset Type 1 Diabetes Using Protein Arrays
Authors:
MsCD00595026
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: None
Insert sequence: 564nts
Open reading frame: 1 to 564

ATGTCAAAAACGGACTGGAATGCATCCGGGCTCTCAAGGCCGAGCCCATCGGCTCACTGG
CCATCGAGGAAGCTATGGCAGCATGGTCAGAAATATCAGACAACCCAGGACAGGAGCGAG
CCACCTGCAGGGAAGAGAAGGCAGGCAGTTCGGGTCTCAGCAAACCATGCCTCTCAGCAA
TTGGATCAACTGAAGGCGGTGCACCTCGCATCCGCGGTCAGGGACCTGGAGAGAGCGATG
ACGACGCTGAAACTTTGGGAATCCCCCCAAGAAATCTCCAGGCATCAAGCACTGGGTTAC
AGTGTTATTACGTTTATGATCACAGCGGTGAAGCGGTTAAGGGAATCCAAGATGCTGACT
CTATCATGGTTCAATCAGGCCTTGATGGTGATAGCACCCTCTCAGGAGGAGACAATGAAT
CTGAAAACAGCGATGTGGATATTGGCGAACCTGATACCGAGGGATATGCTATCACTGACC
GGGGATCTGCTCCCATCTCTATGGGGTTCAGGGCTTCTGATGTTGAAACTGCAGAAGGAG
GGGAGATCCACGAGCTCCTGATAA

Protein sequence predicted based on nucleotide sequence

MSKTDWNASGLSRPSPSAHWPSRKLWQHGQKYQTTQDRSEPPAGKRRQAVRVSANHASQQ
LDQLKAVHLASAVRDLERAMTTLKLWESPQEISRHQALGYSVITFMITAVKRLRESKMLT
LSWFNQALMVIAPSQEETMNLKTAMWILANLIPRDMLSLTGDLLPSLWGSGLLMLKLQKE
GRSTSS**

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
None
Recommended expression in:
Not Applicable