CFTR (Homo sapiens) in pSGX4

Explanation of Terms

Gene:
Gene Symbol:  CFTR
Gene Name:  cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7)
Original Clone ID:
2935c469BSt1p1
Keyword:
Partial Protein, NBD1 domain
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pSGX4
Format: 
FUSION
Source:
SGX Pharmaceuticals, Inc.
Description:
This clone encodes the NBD1 domain with other intended mutations and corresponds to region 387-646 on full length protein NP_000483.3.
Comments:
N-terminal 6-His and Smt3, cleavable, TOPO. Insert sequence of this clone was provided by clone submitter and was not fully sequence verified.
Mutation / Discrepancy:
Yes / Unknown
Publications:
PMID: 17729305
Title: A minimal human CFTR first nucleotide binding domain head-to-tail homodimer
Authors:
SGX Pharmaceuticals, Inc.
HsCD00287374
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI/Smt3/SUMO
Insert sequence: 687nts
Open reading frame: 1 to 687

ACGACTACAGAAGTAGTGATGGAGAATGTAACAGCCTTCTGGGAGGAGGGAGGTACTCCT
GTCCTGAAAGATATTAATTTCAAGATAGAAAGAGGACAGTTGTTGGCGGTTGCTGGATCC
ACTGGAGCAGGCAAGACTTCACTTCTAATGATGATTATGGGAGAACTGGAGCCTTCAGAG
GGTAAAATTAAGCACAGTGGAAGAATTTCATTCTGTTCTCAGTTTTCCTGGATTATGCCT
GGCACCATTAAAGAAAATATCATCTTTGGTGTTTCCTATGATGAATATAGATACAGAAGC
GTCATCAAAGCATGCCAACTAGAAGAAGACATCTCCAAGTTTGCAGAGAAAGACAATATA
GTTCTTGGAGAAGGTGGAATCACACTGAGTGGAGGTCAACGAGCAAGAATTTCTTTAGCA
AGAGCAGTATACAAAGATGCTGATTTGTATTTATTAGACTCTCCTTTTGGATACCTAGAT
GTTTTAACAGAAAAAGAAATATTTGAAAGCTGTGTCTGTAAACTGATGGCTAACAAAACT
AGGATTTTGGTCACTTCTAAAATGGAACATTTAAAGAAAGCTGACAAAATATTAATTTTG
CATGAAGGTAGCAGCTATTTTTATGGGACATTTTCAGAACTCCAAAATCTACAGCCAGAC
TTTAGCTCAAAACTCATGGGATGATAA

Protein sequence predicted based on nucleotide sequence

TTTEVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE
GKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNI
VLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKT
RILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMG**

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
End read sequencing of cDNA insert
Reference Sequence Annotations:
Start on protein reference sequence 387
End on protein reference sequence 646
Mutations:
del405-436

del@405,31

Discrepancy:
None
Others:
Termini 387-646
Domain NBD1
5' Linker Sequence:
ACAGAGAACAGATTGGTGGATCCCTT
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: 50ug/mL kanamycin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Conditions for Gateway-type vectors in recombined (with insert) form and other kanamycin resistant vectors.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
ProteinPurified: Protein_Purified
SolubleProtein: Tested_Not_Soluble
Find experimental protocols in 2935c
Recommended expression in:
Not Applicable