DUSP1 (Homo sapiens) in pSGX4

Explanation of Terms

Gene:
Gene Symbol:  DUSP1
Gene Name:  dual specificity phosphatase 1
Original Clone ID:
8651a3BSt4p1
Keyword:
None
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pSGX4
Format: 
CLOSED
Source:
New York SGX Research Center for Structural Genomics
Description:
None
Comments:
N-terminal 6-His and Smt3, cleavable, TOPO
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
PSI
New York SGX Research Center for Structural Genomics
HsCD00291599
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI/Smt3/SUMO
Insert sequence: 435nts
Open reading frame: 51 to 485

AGGATAACGATATTATTGAGGCTCACAGAGAACAGATTGGTGGATCCCTTCAGGGTGGCC
CGGTGGAAATCCTGCCCTTTCTGTACCTGGGCAGTGCGTATCACGCTTCCCGCAAGGACA
TGCTGGATGCCTTGGGCATAACTGCCTTGATCAACGTCTCAGCCAATTGTCCCAACCATT
TTGAGGGTCACTACCAGTACAAGAGCATCCCTGTGGAGGACAACCACAAGGCAGACATCA
GCTCTTGGTTCAACGAGGCCATTGACTTCATAGACTCCATCAAGAATGCTGGAGGAAGGG
TGTTTGTCCACTGCCAGGCAGGCATTTCCCGGTCAGCCACCATCTGCCTTGCTTACCTTA
TGAGGACTAATCGAGTCAAGCTGGACGAGGCCTTTGAGTTTGTGAAGCAGAGGCGAAGCA
TCATCTCTCCCAACTTCAGCTTCATGGGCCAGCTGCTGCAGTTTGAGTCCCAGGTGCTGG
CTTAAGGGTAACTCGAGCACCACCACCACCACC

Protein sequence predicted based on nucleotide sequence

QGGPVEILPFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHK
ADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQ
RRSIISPNFSFMGQLLQFESQVLA*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Reference Sequence Annotations:
Start on reference sequence 1
End on reference sequence 435
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
ACAGAGAACAGATTGGTGGATCCCTT
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: 50ug/mL kanamycin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Conditions for Gateway-type vectors in recombined (with insert) form and other kanamycin resistant vectors.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
SolubleProtein: Protein_Soluble
ProteinPurified: Tested_Not_Purified
Find experimental protocols in NYSGXRC-8651a
Recommended expression in:
Not Applicable