Detailed Plasmid Information

Explanation of Terms

Gene:
Gene Symbol: 
Gene Name:  None
Original Clone ID:
2399.1.03_GO.33810
Keyword:
None
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pVP68K
Format: 
CLOSED
Source:
Center for Eukaryotic Structural Genomics
Description:
None
Comments:
His8-MBP fusion prtotein with TEV cleavage site downstream from SgfI site; after cleavage the protein obtained will be the translated CDS with the addition of SER at the N-term
Mutation / Discrepancy:
No / No
Publications:
PMID: 18287285
Title: The solution structure of ZNF593 from Homo sapiens reveals a zinc finger in a predominantly unstructured protein.
Authors:
University of Wisconsin Madison
PSI
Center for Eukaryotic Structural Genomics
HsCD00297593
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 312nts
Open reading frame: 50 to 361

CTTCCAGTCCAAGGCGAAGCGGCGGCGGCCGGACTTGGATGAGATTCACCGCGAGCTGCG
GCCTCAGGGATCCGCACGACCCCAGCCCGACCCAAACGCCGAGTTCGACCCCGACCTGCC
AGGGGGCGGTCTGCACCGCTGTCTGGCCTGCGCGAGGTACTTCATCGATTCCACCAACCT
GAAGACCCACTTCCGATCCAAAGACCACAAGAAAAGGCTGAAGCAGCTGAGCGTCGAGCC
CTACAGTCAGGAAGAGGCGGAGAGGGCAGCGGGTATGGGATCCTATGTGCCCCCCAGGCG
GCTGGCAGTGCCCACGGAAGTGTCCACTGAGGTCCCTGAGATGGATACCTCTACCTGATA
GTTTAAACGAATTCGAGCTCGGTACCCGGGGATCCTCTAGAGTCGACCTG

Protein sequence predicted based on nucleotide sequence

RELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQL
SVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST**

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Reference Sequence Annotations:
Start on reference sequence 1
End on reference sequence 381
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: 50ug/mL kanamycin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Conditions for Gateway-type vectors in recombined (with insert) form and other kanamycin resistant vectors.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
ProteinPurified: Protein_Purified
SolubleProtein: Protein_Soluble
Find experimental protocols in GO.33810
Recommended expression in:
Not Applicable