PTPRU (H. sapiens )
In pSGX3 (His-tagged bacterial expression vector)

Explanation of Terms

Gene:
Gene Symbol:  PTPRU
Gene Name:  protein tyrosine phosphatase, receptor type, U
Original Clone ID:
8709a13BCt10p1
Keyword:
None
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pSGX3
Format: 
CLOSED
Source:
New York SGX Research Center for Structural Genomics
Description:
None
Comments:
C-terminal 6-His, TOPO
Mutation / Discrepancy:
No / Yes
Publications:
None
Authors:
PSI
New York SGX Research Center for Structural Genomics
HsCD00297779
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 882nts
Open reading frame: 47 to 928

TCTAAATATTTTGTTTACTTTAGAAGGAGATATACATATGTCCCTTGCGGTGCGTGTCGC
AGACCTTCTGCAGCACATCAACCAGATGAAGACGGCCGAGGGTTACGGCTTCAAGCAGGA
GTATGAGAGCTTCTTTGAAGGCTGGGACGCCACAAAGAAGAAAGACAAGGTCAAGGGCAG
CCGGCAGGAGCCAATGCCTGCCTATGATCGGCACCGAGTGAAACTGCACCCGATGCTGGG
AGACCCCAGTGCCGACTACATTAATGCCAACTACATAGATGGTTACCACAGGTCAAACCA
CTTCATAGCCACTCAAGGGCCGAAGCCTGAGATGGTCTATGACTTCTGGCGTATGGTGTG
GCAGGAGCACTGTTCCAGCATCGTCATGATCACCAAGCTGGTCGAGGTGGGCAGGGTGAA
ATGCTCACGGTACTGGCCGGAGGACTCAGACACCTACGGGGACATCAAGATTATGCTGGT
GAAGACAGAGACCCTGGCTGAGTATGTCGTGCGCACTTTTGCCCTGGAGCGGAGAGGCTA
CTCTGCCCGGCACGAGGTCCGCCAGTTCCACTTCACAGCGTGGCCAGAGCATGGCGTCCC
CTACCATGCCACGGGGCTGCTGGCTTTCATCCGGCGCGTGAAGGCCTCCACCCCACCTGA
TGCCGGGCCCATTGTCATCCACTGCAGCGCGGGCACCGGCCGCACAGGTTGCTATATCGT
CCTGGATGTGATGCTGGACATGGCAGAGTGTGAGGGCGTCGTGGACATTTACAACTGTGT
GAAGACTCTCTGCTCCCGGCGTGTCAACATGATCCAGACTGAGGAGCAGTACATCTTCAT
TCATGATGCAATCCTGGAGGCCTGCCTGTGTGGGGAGACCACCATCCCTGTCAGTGAGTT
CGAAGGGCATCATCACCATCACCACTGATCCGAATTCGAGCTCCGTCGACAAGCTTGCGG
CCGCACTCGAGCACCAC

Protein sequence predicted based on nucleotide sequence

AVRVADLLQHINQMKTAEGYGFKQEYESFFEGWDATKKKDKVKGSRQEPMPAYDRHRVKL
HPMLGDPSADYINANYIDGYHRSNHFIATQGPKPEMVYDFWRMVWQEHCSSIVMITKLVE
VGRVKCSRYWPEDSDTYGDIKIMLVKTETLAEYVVRTFALERRGYSARHEVRQFHFTAWP
EHGVPYHATGLLAFIRRVKASTPPDAGPIVIHCSAGTGRTGCYIVLDVMLDMAECEGVVD
IYNCVKTLCSRRVNMIQTEEQYIFIHDAILEACLCGETTIPVSEFEGHHHHHH*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Reference Sequence Annotations:
Start on reference sequence 1
End on reference sequence 882
Mutations:
None
Discrepancy:
"a203g,N68S;"
                                                    

5' Linker Sequence:
ATGTCCCTT
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: 50ug/mL kanamycin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Conditions for Gateway-type vectors in recombined (with insert) form and other kanamycin resistant vectors.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
SolubleProtein: Protein_Soluble
ProteinPurified: Tested_Not_Purified
Find experimental protocols in NYSGXRC-8709a
Recommended expression in:
Not Applicable