Detailed Plasmid Information

Explanation of Terms

Gene:
Gene Symbol: 
Gene Name:  None
Original Clone ID:
72254
Keyword:
SP or TM removed
Species:
Bacteroides uniformis ATCC 8492
Type:
cDNA
Vector Name:
pSpeedET
Format: 
FUSION
Source:
Joint Center for Structural Genomics
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
PSI
Joint Center for Structural Genomics
BuCD00323307
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 348nts
Open reading frame: 51 to 398

CTGATAAAATTCATCATCATCATCATCACGAAAACCTGTACTTCCAGGGCTGCATGAATG
GTGGGGGTGACTTGGCCGGTAAGTGGCAGTTGCGTCAGTATCAATATGCCGACGGTACAT
CAGAGAAGGTGGACAGTGTATTCTATAATTTTCAAAAAGGAAGTTTTTCTGCCATATGTT
TGTTGAAAGATGGAGGGTTGACTACGTTTTTTGGAAATTATTCTTTGAAAGGTGCTGAAA
TTTCCATTATTTTGTTGCCTGAAAGCGTTAACGATAAAAATTATGATACTTATTTCGGGT
GGCCGGAAGGAAAATGTACCTTTAAAGTAGAAGATTTGTCCTACTCTTCATTGCGTTTGG
AATATGAGGGCACGAAATCTATTTTTCGAAAATTTTAACGCGACTTAATTAA

Protein sequence predicted based on nucleotide sequence

CMNGGGDLAGKWQLRQYQYADGTSEKVDSVFYNFQKGSFSAICLLKDGGLTTFFGNYSLK
GAEISIILLPESVNDKNYDTYFGWPEGKCTFKVEDLSYSSLRLEYEGTKSIFRKF*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
ATGGGATCTGATAAAATTCATCATCATCATCATCACGAAAACCTGTACTTCCAGGGC
3' Linker Sequence:
TAACGCGACTTAATTAA

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: 50ug/mL kanamycin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Conditions for Gateway-type vectors in recombined (with insert) form and other kanamycin resistant vectors.
Protein Expression Results:
ProteinExpressed: Not_Applicable
ProteinPurified: Not_Applicable
SolubleProtein: Not_Applicable
Find experimental protocols in 417932
Recommended expression in:
Not Applicable