CDX2 (Homo sapiens) in pLenti6.2/V5-DEST

Explanation of Terms

Gene:
Gene Symbol:  CDX2
Gene Name:  caudal type homeobox 2
Original Clone ID:
FLH269287.01L
Keyword:
STOP codon removed based on OC annotation
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pLenti6.2/V5-DEST
Format: 
FUSION
Source:
HIP
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
HsCD00330239
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: None
Insert sequence: 939nts
Open reading frame: 1 to 939

ATGTACGTGAGCTACCTCCTGGACAAGGACGTGAGCATGTACCCTAGCTCCGTGCGCCAC
TCTGGCGGCCTCAACCTGGCGCCGCAGAACTTCGTCAGCCCCCCGCAGTACCCGGACTAC
GGCGGTTACCACGTGGCGGCCGCAGCTGCAGCGGCAGCGAACTTGGACAGCGCGCAGTCC
CCGGGGCCATCCTGGCCGGCAGCGTATGGCGCCCCACTCCGGGAGGACTGGAATGGCTAC
GCGCCCGGAGGCGCCGCGGCCGCCGCCAACGCCGTGGCTCACGGCCTCAACGGTGGCTCC
CCGGCCGCAGCCATGGGCTACAGCAGCCCCGCAGACTACCATCCGCACCACCACCCGCAT
CACCACCCGCACCACCCGGCCGCCGCGCCTTCCTGCGCTTCTGGGCTGCTGCAAACGCTC
AACCCCGGCCCTCCTGGGCCCGCCGCCACCGCTGCCGCCGAGCAGCTGTCTCCCGGCGGC
CAGCGGCGGAACCTGTGCGAGTGGATGCGGAAGCCGGCGCAGCAGTCCCTCGGCAGCCAA
GTGAAAACCAGGACGAAAGACAAATATCGAGTGGTGTACACGGACCACCAGCGGCTGGAG
CTGGAGAAGGAGTTTCACTACAGTCGCTACATCACCATCCGGAGGAAAGCCGAGCTAGCC
GCCACGCTGGGGCTCTCTGAGAGGCAGGTTAAAATCTGGTTTCAGAACCGCAGAGCAAAG
GAGAGGAAAATCAACAAGAAGAAGTTGCAGCAGCAACAGCAGCAGCAGCCACCACAGCCG
CCTCCGCCGCCACCACAGCCTCCCCAGCCTCAGCCAGGTCCTCTGAGAAGTGTCCCAGAG
CCCTTGAGTCCGGTGTCTTCCCTGCAAGCCTCAGTGTCTGGCTCTGTCCCTGGGGTTCTG
GGGCCAACTGGGGGGGTGCTAAACCCCACCGTCACCCAG

Protein sequence predicted based on nucleotide sequence

MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQS
PGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPH
HHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ
VKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAK
ERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVL
GPTGGVLNPTVTQ

Coding Sequence Details

Insert Sequence Verified?:
N
Verification Method:
Insert was fully sequenced in parent vector
Reference Sequence Annotations:
End on reference sequence 1116
Start on reference sequence 175
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
5p GTACAAAAAAGCAGGCTCCACC(atg-goi)
3' Linker Sequence:
5p (goi-stop)GACCCAGCTTTCTTGTAC

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Host Type:  mammalian    Marker:  blasticidin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
None
Recommended expression in:
Not Applicable