Detailed Plasmid Information

Explanation of Terms

Gene:
Gene Symbol:  SPRED1
Gene Name:  sprouty-related, EVH1 domain containing 1
Original Clone ID:
HR5538B-13-127-14.15
Keyword:
targeted domain
Species:
Homo sapiens
Type:
cDNA
Vector Name:
pET15_NESG
Format: 
CLOSED
Source:
Northeast Structural Genomics Consortium
Description:
None
Comments:
None
Mutation / Discrepancy:
No / Yes
Publications:
None
Authors:
PSI
Northeast Structural Genomics Consortium
HsCD00331904
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI/NESG
Insert sequence: 351nts
Open reading frame: 1 to 351

ATGAGTTATGCACGAGTGCGAGCTGTGGTGATAACCCGAGATGACTCAAGTGGTGGATGG
TTACCACTTGGAGGGAGTGGACTAAGCAGCGTCACTGTCTTCAAAGTCCCTCATCAGGAA
GAGAATGGCTGTGCTGACTTTTTTATCCGTGGAGAGCGACTCAGGGACAAAATGGTGGTT
TTGGAATGTATGCTTAAAAAAGACCTCATTTATAATAAGGTCACTCCAACATTTCACCAC
TGGAAGATTGATGACAAAAAGTTTGGTCTTACGTTTCAAAGTCCTGCTGATGCTAGGGCT
TTTGATAGAGGTATCCGAAGAGCTATTGAGGATATTTCTCAAGGATGCTAG

Protein sequence predicted based on nucleotide sequence

MSYARVRAVVITRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVV
LECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGC*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
g33a,M11I,a327t,I109I,
                                                    

5' Linker Sequence:
ATGGGCCATCACCATCACCATCACAGCCAT
3' Linker Sequence:
CTCGAGATCCGGCTGC

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
ProteinPurified: Protein_Purified
SolubleProtein: Protein_Soluble
Find experimental protocols in HR5538B
Recommended expression in:
Not Applicable