Reut_B4987 (R. eutropha JMP134 )
In pSpeedET (bacterial expression vector)

Explanation of Terms

Gene:
Gene Symbol:  Reut_B4987
Gene Name:  BNR repeat-containing glycosyl hydrolase
Original Clone ID:
34219
Keyword:
full-length cds
Species:
Ralstonia eutropha JMP134
Type:
cDNA
Vector Name:
pSpeedET
Format: 
CLOSED
Source:
Joint Center for Structural Genomics
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
PSI
Joint Center for Structural Genomics
RrCD00335772
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 1182nts
Open reading frame: 1 to 1182

ATGACAGCTAGCACGGCACCGCAAACCGAACCCCACAAGACGTCAGCTCCGGAATCCGGC
CCGGTCATGCTGCTGGTCGCCACGATCAAGGGCGCGTGGTTCCTGGCCAGTGACCCCGCG
CGCCGCACCTGGGAACTGCGTGGGCCGGTATTCCTCGGGCACACCATCCACCACATCGTG
CAGGATCCGCGGGAACCGGAGCGCATGCTGATGGCGGCGCGCACCGGCCATCTGGGACCG
ACGGTATTCCGTTCGGACGACGGCGGCGGCAACTGGACCGAGGCCACGCGCCCACCGGCG
TTCAACAAGGCCCCCGAAGGTGAAACCGGCCGCGTGGTCGACCATGTCTTCTGGCTCACG
CCCGGACATGCGTCCGAACCCGGCACGTGGTATGCCGGCACCTCTCCGCAAGGCTTGTTC
CGCAGTACCGATCACGGTGCGAGCTGGGAGCCGGTGGCCGGCTTCAATGATCACCCGATG
CGGCGCGCCTGGACCGGCGGCGAACAGGACGGCACGCCCGACGGCCCAAAGATGCATTCC
ATCCTTGTCGATCCGCGCGATCCGAAGCACCTCTACATCGGCATGTCGAGCGGCGGCGTA
TTCGAAAGCACCGATGCGGGTACCGACTGGAAGCCGCTGAACCGCGGTTGCGCCGCGAAT
TTCCTGCCGGACCCCAACGTCGAATTCGGCCATGACCCGCACTGCGTGGTGCAGCATCCG
GCTGCGCCTGACATCCTGTACCAGCAAAACCACTGCGGCATCTATCGCATGGACCGGCGC
GAAGGGGTGTGGAAGCGCATCGGCGACGCCATGCCGCGCGAGGTTGGGGATATCGGCTTC
CCGATCGTCGTGCATCAGCGCGATCCACGCACGGTATGGGTCTTCCCGATGGATGGCAGC
GACGTCTGGCCCCGCGTGAGCCCCGGCGGCAAGCCCGCGGTCTATGTCACGCGCGACGCA
GGCGAGTCGTGGCAGCGGCAGGATCGTGGCCTGCCCACCGATCAGGCCTGGCTCACCGTC
AAGCGCCAGGCCATGACTGCCGACGCGCACGCGCCTGTGGGGGTGTATTTCGGCACCACC
GGCGGCGAGATCTGGGCCAGTGCCGATGAAGGCGAACACTGGCAGTGCATTGCGAGCCAC
TTGCCGCACATCTACGCGGTCCAGTCGGCACGGCCGGTCTAA

Protein sequence predicted based on nucleotide sequence

MTASTAPQTEPHKTSAPESGPVMLLVATIKGAWFLASDPARRTWELRGPVFLGHTIHHIV
QDPREPERMLMAARTGHLGPTVFRSDDGGGNWTEATRPPAFNKAPEGETGRVVDHVFWLT
PGHASEPGTWYAGTSPQGLFRSTDHGASWEPVAGFNDHPMRRAWTGGEQDGTPDGPKMHS
ILVDPRDPKHLYIGMSSGGVFESTDAGTDWKPLNRGCAANFLPDPNVEFGHDPHCVVQHP
AAPDILYQQNHCGIYRMDRREGVWKRIGDAMPREVGDIGFPIVVHQRDPRTVWVFPMDGS
DVWPRVSPGGKPAVYVTRDAGESWQRQDRGLPTDQAWLTVKRQAMTADAHAPVGVYFGTT
GGEIWASADEGEHWQCIASHLPHIYAVQSARPV*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: 50ug/mL kanamycin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Conditions for Gateway-type vectors in recombined (with insert) form and other kanamycin resistant vectors.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
ProteinPurified: Protein_Purified
SolubleProtein: Protein_Soluble
Find experimental protocols in 377390
Recommended expression in:
Not Applicable