Detailed Plasmid Information

Explanation of Terms

Gene:
Gene Symbol: 
Gene Name:  None
Original Clone ID:
9260c1BCt10p1
Keyword:
None
Species:
Unknown
Type:
cDNA
Vector Name:
pSGX3
Format: 
CLOSED
Source:
New York SGX Research Center for Structural Genomics
Description:
None
Comments:
Linker not verified.
Mutation / Discrepancy:
No / No
Publications:
PMID: 20604542
Title: Functional identification and structure determination of two novel prolidases from cog1228 in the amidohydrolase superfamily
Authors:
PSI
New York SGX Research Center for Structural Genomics
UnCD00534390
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 1263nts
Open reading frame: 51 to 1313

CTAGAAATAATTTTGTTTAACTTTAAGAAGGAGATATACATATGTCCCTTACTATTACGG
TGCTGCAGGGCGGTAATGTGCTGGATTTGGAACGTGGGGTCCTTCTCGAGCATCACCATG
TAGTGATCGACGGAGAACGCATAGTTGAGGTCACTGATCGGCCGGTAGACCTGCCAAACG
CGCAAGCCATTGATGTGAGAGGCAAAACAGTTATGCCTGGTTTTATCGACTGCCACGTCC
ATGTGCTGGCAAGCAATGCTAACTTAGGGGTAAATGCGACCCAGCCCAACATTTTGGCCG
CAATCCGATCTCTTCCGATACTGGATGCTATGCTCAGTCGTGGATTCACGTCAGTTCGCG
ATGCGGGCGGTGCCGACTGGTCCCTGATGCAAGCAGTGGAAACTGGCTTAGTCTCGGGTC
CACGTATTTTTCCTAGCGGGAAGGCTCTGTCTCAGACAGGAGGCCACGGTGATTTCCGCC
CGCGGGGCGACTTGCTTGAACCCTGTAGTTGCTGTTTTCGTACCGGTGCGATCGCCCGCG
TTGTAGATGGGGTGGAGGGAGTCAGACTGGCAGTTCGAGAAGAGATTCAGAAAGGCGCTA
CGCAAATAAAAATCATGGCGTCAGGTGGGGTGGCCTCCCCGACCGACCCAATTGCAAATA
CTCAGTATTCGGAAGATGAAATCCGTGCGATTGTAGATGAGGCTGAAGCCGCAAACACAT
ACGTCATGGCGCATGCTTATACGGGCCGCGCCATAGCACGGGCGGTTCGTTGCGGTGTGC
GCACCATCGAGCACGGAAATCTCGTAGACGAAGCTGCCGCAAAGTTAATGCATGAACACG
GCGCGTTCGTTGTGCCTACTCTGGTCACATACGATGCCTTGGCAAAACATGGTGCGGAGT
TTGGGATGCCGCCCGAAAGCGTTGCTAAAGTGGCCTCTGTACAACAGAAGGGCCGTGAGA
GTCTTGAAATTTATGCGAACGCTGGTGTCAAAATGGGATTCGGCTCAGACCTGTTAGGTG
AAATGCACGCATTTCAGTCCGGGGAGTTCCGCATAAGAGCCGAAGTTCTGGGAAATCTCG
AAGCGCTGCGATCGGCTACCACGGTGGCAGCCGAGATCGTAAACATGCAAGGCCAGTTGG
GTGTCATTGCGGTTGGGGCTATTGCAGATCTTGTGGTATTAGACGGCAATCCGTTAGAGG
ACATCGGTGTCGTTGCCGATGAGGGAGCGCGGGTGGAATACGTATTACAGCGTGGCACCC
TCGTTAAAAGACAGGCTGCTGGGCGTGAAGGGCATCATCACCATCACCACTGA

Protein sequence predicted based on nucleotide sequence

TITVLQGGNVLDLERGVLLEHHHVVIDGERIVEVTDRPVDLPNAQAIDVRGKTVMPGFID
CHVHVLASNANLGVNATQPNILAAIRSLPILDAMLSRGFTSVRDAGGADWSLMQAVETGL
VSGPRIFPSGKALSQTGGHGDFRPRGDLLEPCSCCFRTGAIARVVDGVEGVRLAVREEIQ
KGATQIKIMASGGVASPTDPIANTQYSEDEIRAIVDEAEAANTYVMAHAYTGRAIARAVR
CGVRTIEHGNLVDEAAAKLMHEHGAFVVPTLVTYDALAKHGAEFGMPPESVAKVASVQQK
GRESLEIYANAGVKMGFGSDLLGEMHAFQSGEFRIRAEVLGNLEALRSATTVAAEIVNMQ
GQLGVIAVGAIADLVVLDGNPLEDIGVVADEGARVEYVLQRGTLVKRQAAGREGHHHHHH
*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  kanamycin
Bacterial Selection Condition: 50ug/mL kanamycin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Conditions for Gateway-type vectors in recombined (with insert) form and other kanamycin resistant vectors.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
ProteinPurified: Protein_Purified
SolubleProtein: Protein_Soluble
Find experimental protocols in NYSGXRC-9260c
Recommended expression in:
Not Applicable