Detailed Plasmid Information

Explanation of Terms

Gene:
Gene Symbol: 
Gene Name:  None
Original Clone ID:
OR94-21.1
Keyword:
None
Species:
Unknown
Type:
cDNA
Vector Name:
pET21_NESG
Format: 
FUSION
Source:
Northeast Structural Genomics Consortium
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
Rutgers University
PSI:Biology
Northeast Structural Genomics Consortium
UnCD00663579
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI/NESG
Insert sequence: 738nts
Open reading frame: 1 to 738

ATGAAGATAGTTCCTCCTAAGCCATTTTTCTTTGAAGCAGGTGAAAGAGCCGTTTTATTG
TTGCACGGTTTTACTGGTAATTCCGCCGACGTTAGAATGTTGGGTAGATTTTTAGAATCT
AAGGGTTACACATGTCATGCACCAATCTATTCAGGTCACGGTGTCCCACCTGAAGCTTTG
ACCAGATTTGGTCCTGAAGCATGGTGGCAAGACGTTATGAACGGTTACGAATTCTTGAAA
AATAAGGGTTACGAAAAGATTGCTGTAGCAGGTTTGTCTTTAGGTGGTGTCTTCTCATTG
AAGTTAGGTTATACCGTCCCAATCGAAGGTATTGTTACTATGTGCGCCCCTATGTATATC
AAATCCGAAGAAACCATGTACGAAGGTGTATTGGAATACGCTAGAGAATACAAAAAGAGA
GAGGGTAAATCAGAAGAACAAATCGAACAAGAAATGGAAAAGTTTAAACAAACTCCAATG
TTGACATTAAAGGCCTTGCAAGAATTAATTGCTGATGTTAGAGACCATTTGGATTTGATA
TACGCACCTACTTTCGTTGTACAAGCCAGACACGACGAAATGATCAACCCAGATTCCGCT
AACATCATCTATAACGAAATCGAAAGTCCTGTTAAGCAAATCAAGTGGTACGAACAATCT
GGTCATGTAATTACATTAGATCAAGAAAAGGACCAATTACACGAAGACATATACGCATTT
TTAGAATCATTAGACTGG

Protein sequence predicted based on nucleotide sequence

MKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYSGHGVPPEAL
TRFGPEAWWQDVMNGYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMYI
KSEETMYEGVLEYAREYKKREGKSEEQIEQEMEKFKQTPMLTLKALQELIADVRDHLDLI
YAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAF
LESLDW

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
ProteinExpressed: Protein_Confirmed
ProteinPurified: Protein_Purified
SolubleProtein: Protein_Soluble
Find experimental protocols in OR94
Recommended expression in:
Not Applicable