xbp1 (Xenopus laevis) in pDONR223 (Gateway donor/master vector)

Explanation of Terms

Gene:
Gene Symbol:  xbp1
Gene Name:  X-box binding protein 1
Original Clone ID:
None
Keyword:
None
Species:
Xenopus laevis
Type:
cDNA
Vector Name:
pDONR223
Format: 
FUSION
Source:
Xenopus Gene Collection
Description:
None
Comments:
The ORFeome Collaboration, REVERSE_PRIMER: GGGGACAACTTTGTACAAGAAAGTTGGCAAAAAATGTACATCAAACTCTGAGCT, FORWARD_PRIMER: GGGGACAACTTTGTACAAAAAAGTTGGCACCATGGTGGTCGTGGGAGC, XGC Collection: IRBH
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
Center for Cancer Systems Biology
Cincinnati Children's Hospital Medical Center
MRC National Institute for Medical Research
University of Virginia School of Medicine
Aaron Zorn
David E. Hill
Michael J. Gilchrist
Todd Stukenberg
Xenopus Gene Collection
XlCD00715279
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: None
Insert sequence: 1188nts
Open reading frame: 1 to 1188

ATGGTGGTCGTGGGAGCCCCCAAAGTGATCTTTATTCCCGGGAATCAGTGTGAGCAGGCC
GACGCCTTGGGATCCGTAATGTTACCCATAAGCAGCCCGAGCAGTCCGGAGTCCGTCAGC
AATGAGCAACCCCCAAGGAAGAGACAGAGACTCACCCACCTTAGCTCGGAGGAAAAAGCG
CTTAGAAGAAAATTAAAAAACAGAGTAGCAGCACAGACTGCTCGGGACAGGAAAAAAGCC
AGAATGAGTGAACTGGAACAGCAAGTGATAGATTTAGAAATGGAGAATGAGAAGCTTTTA
ATTGAAAACCAGATTTTAAGAGAAAAATCTCACGGCTTGTTGACTGAAAACCAGGAGCTA
CGCCAAAGATTGGGCCTTAGCACCCTGGAGTTAAAGGAAGAAGAAGAAGAAGAATCACAG
GAGCTGAATCAGTCCAGAAAAGATAAAGTCAGGCCGGAGACCGGGTCCGCTGAGTCCGCA
GCAGGAGCAGGCCCAGATGTCTCTGAACCTGACAGTGTCTACATGGATCCTGACAGCCCT
GACACTTCAGACTCTGAGTCTGATCTCTTGTTGGGCCTTCTGGAAAGCCTGGACTCAGAC
TTGTTGCTTGCCTATGAAGGAGCACTTGCTGGAAGCCCAGATGAAGAGCTCAAGGGAGAA
GAATCAGATTCCATATCCTCCTCCCCATCTTCTCCTGTGGGGACCCCATCAGCCAAGCTG
GACGCCATTAATGAACTGATCCGATTCGATCACGTGTACACCAAGCCACTAAGCACAGAG
GAAGACTCTGCGCAAGGTGTTGAGACCAGCATAGTAGTTAAAATGGAGGAAGCATCTTTC
AGCCCTACCTGCGAAGATGACCTGACCTGTGTGAAACAGGAACCACAAGAAGATGACCTA
GTCCCCATCCTCGGAATGCAAAGCTTTTTGCCCTGTTCTGAAAACAACCTTGAAAAATCA
TCTAACATATTGGATACAGGAAGTGACTCTGGCTATGAAGGGTGTTCTTCACCCTTCAGT
GACCTGTCCTCTCCTCTGAACTCTGACCGGGTTTGGGAAGACTCGTTCAGTACCGAACTT
TTCCCCCAGCTTCTCCTCAGTGCCCATATGGACCAATCCATTTGTCCTTCATCTCCTGTT
GATGCCGTTTCTTTCTGGAGTCATAGCTCAGAGTTTGATGTACATTTTTAA

Protein sequence predicted based on nucleotide sequence

MVVVGAPKVIFIPGNQCEQADALGSVMLPISSPSSPESVSNEQPPRKRQRLTHLSSEEKA
LRRKLKNRVAAQTARDRKKARMSELEQQVIDLEMENEKLLIENQILREKSHGLLTENQEL
RQRLGLSTLELKEEEEEESQELNQSRKDKVRPETGSAESAAGAGPDVSEPDSVYMDPDSP
DTSDSESDLLLGLLESLDSDLLLAYEGALAGSPDEELKGEESDSISSSPSSPVGTPSAKL
DAINELIRFDHVYTKPLSTEEDSAQGVETSIVVKMEEASFSPTCEDDLTCVKQEPQEDDL
VPILGMQSFLPCSENNLEKSSNILDTGSDSGYEGCSSPFSDLSSPLNSDRVWEDSFSTEL
FPQLLLSAHMDQSICPSSPVDAVSFWSHSSEFDVHF

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
End read sequencing
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Host Type:  bacterial    Marker:  spectinomycin
Bacterial Selection Condition: 100 ug/mL spectinomycin
Growth Condition: Growth at 37 degrees C in LB supplemented with 100 ug/mL spectinomycin.
Comments: None
Protein Expression Results:
None
Recommended expression in:
Not Applicable