Detailed Plasmid Information

Explanation of Terms

Gene:
Gene Symbol: 
Gene Name:  None
Original Clone ID:
anti-ALX3-RAB-T37
Keyword:
recombinant antibody fab fragment; rAB expression protocol URL: http://recombinant-antibodies.org/protocols/rh22-avi; Sequencing primer heavy chain: GTAAAACGACGGCCAGTACTCGAGGCTGAGCAAAGC/CAGGAAACAGCTATGACCGCGACAGAATCAAGTTTGCC
Species:
Homo sapiens
Type:
cDNA
Vector Name:
RH2.2-Avi
Format: 
CLOSED
Source:
Recombinant Antibody Network
Description:
None
Comments:
None
Mutation / Discrepancy:
No / No
Publications:
None
Authors:
The University of Chicago
Recombinant Antibody Network
HsCD00751498
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: SPTA
Insert sequence: 765nts
Open reading frame: 1 to 765

GAGGTTCAGCTGGTGGAGTCTGGCGGTGGCCTGGTGCAGCCAGGGGGCTCACTCCGTTTG
TCCTGTGCAGCTTCTGGCTTCAACATCTCTTCTTCTTCTATCCACTGGGTGCGTCAGGCC
CCGGGTAAGGGCCTGGAATGGGTTGCATCTATTTATCCTTCTTATGGCCCTACTTATTAT
GCCGATAGCGTCAAGGGCCGTTTCACTATAAGCGCAGACACATCCAAAAACACAGCCTAC
CTACAAATGAACAGCTTAAGAGCTGAGGACACTGCCGTCTATTATTGTGCTCGCTCTTGG
TCTGTTTGGTCTGGTTACTACGCTTCTTGGTGGTGGCCGGGTGCTATTGACTACTGGGGT
CAAGGAACCCTGGTCACCGTCTCCTCGGCCTCCACCAAGGGTCCATCGGTCTTCCCCCTG
GCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGAC
TACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCAC
ACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTG
CCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAAC
ACCAAGGTCGACAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCACACAGGTGGCGGT
CTGAACGACATCTTCGAGGCTCAGAAAATCGAATGGCACGAATAA

Protein sequence predicted based on nucleotide sequence

EVQLVESGGGLVQPGGSLRLSCAASGFNISSSSIHWVRQAPGKGLEWVASIYPSYGPTYY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSWSVWSGYYASWWWPGAIDYWG
QGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVH
TFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTGGG
LNDIFEAQKIEWHE*

Coding Sequence Details

Insert Sequence Verified?:
N
Verification Method:
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
None
3' Linker Sequence:
None

Recommended Growth Condition:

Distributed in bacterial strain:
DH5-alpha T1 phage resistant
Antibiotic Selection:
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
ProteinExpressed: Protein_Expressed
ProteinPurified: Protein_Purified
SolubleProtein: Protein_Soluble
Recommended expression in:
Not Applicable