TM0077 (T. maritima ) in pMH1 (bacterial expression vector)

Explanation of Terms

Gene:
Gene Symbol:  TM0077
Gene Name:  acetyl xylan esterase
Original Clone ID:
7035
Keyword:
None
Species:
Thermotoga maritima
Type:
cDNA
Vector Name:
pMH1
Format: 
CLOSED
Source:
Joint Center for Structural Genomics
Description:
None
Comments:
Next amino acid codon after CDS represents STOP, hence clone should be labeled for CDS 'fusion', overall 'closed'
Mutation / Discrepancy:
No / No
Publications:
PMID: 22659119
Title: The structural basis for the narrow substrate specificity of an acetyl esterase from Thermotoga maritima
PMID: 27085421
Title: An extended loop in CE7 carbohydrate esterase family is dispensable for oligomerization but required for activity and thermostability
Authors:
PSI
Joint Center for Structural Genomics
TmCD00083900
Price: 
Login for Pricing
AVAILABLE
No restriction
Special MTA: PSI
Insert sequence: 978nts
Open reading frame: 37 to 1014

ATGGGATCTGATAAAATTCATCATCATCATCATCACATGGCCTTCTTCGATTTACCACTC
GAAGAACTGAAGAAATATCGTCCAGAGCGGTACGAAGAGAAAGACTTCGATGAGTTCTGG
GAAGAGACACTCGCAGAGAGCGAAAAGTTCCCCTTAGACCCCGTCTTCGAGAGGATGGAG
TCTCACCTCAAAACAGTCGAAGCGTACGATGTCACCTTCTCCGGATACAGGGGACAGAGG
ATCAAAGGGTGGCTCCTTGTTCCAAAACTGGAAGAAGAAAAACTTCCCTGCGTTGTGCAG
TACATAGGATACAACGGTGGAAGAGGATTCCCTCACGACTGGCTGTTCTGGCCTTCTATG
GGTTACATATGTTTCGTCATGGATACTCGAGGTCAGGGAAGCGGCTGGCTGAAAGGAGAC
ACACCGGATTACCCTGAGGGTCCCGTTGACCCTCAGTATCCAGGATTCATGACAAGAGGA
ATACTGGATCCCAGAACTTACTACTACAGACGAGTCTTCACGGACGCTGTCAGAGCCGTT
GAAGCTGCTGCTTCTTTTCCTCAGGTAGATCAAGAAAGAATCGTGATAGCTGGAGGCAGT
CAGGGTGGCGGAATAGCCCTTGCGGTGAGCGCTCTCTCAAAGAAAGCAAAGGCTCTTCTG
TGCGATGTGCCGTTTCTGTGTCACTTCAGAAGAGCAGTACAGCTTGTGGATACGCATCCA
TACGCGGAGATCACGAACTTTCTAAAGACCCACAGAGACAAGGAAGAAATCGTGTTCAGG
ACTCTTTCCTATTTCGATGGAGTGAACTTCGCAGCCAGAGCGAAGATCCCTGCGCTGTTT
TCTGTGGGTCTCATGGACAACATTTGTCCTCCTTCAACGGTTTTCGCTGCCTACAATTAC
TACGCTGGACCGAAGGAAATCAGAATCTATCCGTACAACAACCACGAGGGAGGAGGCTCT
TTCCAAGCGGTTGAACAGGTGAAATTCTTGAAAAAACTATTTGAGAAAGGCTAAGTTTAA
ACGGTCTCCAG

Protein sequence predicted based on nucleotide sequence

MAFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVT
FSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQ
GSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQE
RIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHR
DKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPY
NNHEGGGSFQAVEQVKFLKKLFEKG*

Coding Sequence Details

Insert Sequence Verified?:
Y
Verification Method:
Sequence Verification
Reference Sequence Annotations:
Start on reference sequence 1
End on reference sequence 978
Mutations:
None
Discrepancy:
None
5' Linker Sequence:
ATGGGATCTGATAAAATTCATCATCATCATCATCAC
3' Linker Sequence:
GTTTAAACGGTCTCCAG

Recommended Growth Condition:

Distributed in bacterial strain:
DL41
Antibiotic Selection:
Host Type:  bacterial    Marker:  ampicillin
Bacterial Selection Condition: 100 ug/mL ampicillin
Growth Condition: Growth with the single antibiotic in LB at 37 degrees is recommended.
Comments: Commonly used conditions for ampicillin resistant plasmid clones.
Protein Expression Results:
None
Recommended expression in:
Not Applicable